SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023367 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023367
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-37
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 148-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-37
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 262-372
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-33
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023367   Gene: ENSONIG00000018562   Transcript: ENSONIT00000023388
Sequence length 536
Comment pep:novel scaffold:Orenil1.0:GL831198.1:2262030:2265493:-1 gene:ENSONIG00000018562 transcript:ENSONIT00000023388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNNMTLRVTILIHLLLLFDKADSKKGVKCGGILSAPSGNFSSPNFPDLYPYNTHCSWLIV
VAEGSSVLLTFHYFELEYHASCAYDYIKIYNGISEDEGNLLGTFCGDISPPQFTSSWNVM
SIIFHSDRHVAYRGFTVGYRKDMCGGVLTGLSGVISSPGYPQEYSNNADCSWAIHVSNTS
VVTLVFLDFQLENNEGCNFDFVALFDGPTVTHRHLGKYCGADKPPNIITTSNQLLVVFKS
DFNIGGRGFKAYYYSGECQQVLSHVSGNFSSPNFPNIYPNNINCHWSITLAAGYRIKLFF
PLMDLEDRNSLSDECDYDSVTVYDGNSQTDPLMGRWCGREHPSSLVSKGNKLLVVLSTDR
NEAHRGFTASYHGAQVVPVNVSCTRSEFTIVIPQQSLPQLDRESIYLGNPTCAAQLTTTS
YKIVAQFVDCGTASQKHRNITMLVNKLYIDFSDGKQENVQEYKLQCDALRKIASVSIISA
EERRLEEQAQQTDNGSSGNEGDPEAEPHDLSDIVFISICVLAVILMVIAIVWLVLL
Download sequence
Identical sequences I3KQH2
ENSONIP00000023367 ENSONIP00000023367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]