SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023439 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023439
Domain Number 1 Region: 252-576
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-88
Family Protein kinases, catalytic subunit 0.0000000629
Further Details:      
 
Domain Number 2 Region: 13-97
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.05e-23
Family PB1 domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 113-183
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023439   Gene: ENSONIG00000018621   Transcript: ENSONIT00000023460
Sequence length 596
Comment pep:novel scaffold:Orenil1.0:GL831198.1:3226815:3252946:1 gene:ENSONIG00000018621 transcript:ENSONIT00000023460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSRVTGELEVMGGYRTRKLHFSKDIMITHFEPSISYEGLYGEVKDMCSMDNDQLFTMKW
IDEEGDPCTVSSQLELEEALRLYELNKDSELIIHVFPCVPEKPGMPCPGEDKSIYRRGAR
RWRKLYYASGHAFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLATVEC
GRQMIHDPMMPSTQPSQLDPHEQPAVPPPTTRTHTCPENKDSRESLTYDGEEKEARSSRD
TGKSTSSLGLADFDLLRVIGRGSYAKVLLVQLKKTERIYAMKVVKKELVNDDEDIDWVQT
EKHVFEQASNHPFLVGLHSCFQTESSRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
IPRSLSVKAASVLKGFLNKDPKERLGCHPQTGFADIMGHPFFRNVDWELLEHKQVVPPFK
PNISGEYGLDNFDAQFTNEPIQLTPDDEDVVKKIDQSEFEGFEYINPLLMSAEECV
Download sequence
Identical sequences I3KQP4
ENSONIP00000023439 ENSONIP00000023439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]