SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023649 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023649
Domain Number 1 Region: 42-150
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-30
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 2 Region: 164-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000017
Family Pentraxin (pentaxin) 0.0082
Further Details:      
 
Domain Number 3 Region: 818-1100
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000375
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023649   Gene: ENSONIG00000018784   Transcript: ENSONIT00000023670
Sequence length 1211
Comment pep:novel scaffold:Orenil1.0:GL831182.1:2893255:2998627:1 gene:ENSONIG00000018784 transcript:ENSONIT00000023670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METFRGEGGGGRGGRWRLRHVVLVVLLWMTLHRHVLGCASTNCNLVLTESQGEITSPCYP
QRYPNSYNCRWIMKAPAGFIIQLSFLDFELEEAPGCIYDWVKVNTGSAEVVFCGLTANGL
TQNSTGNEMVLSFTSDFSVQKKGFRVSFQHVAVALRNQKIKMSSGVGQITKVANSVSIPA
LSQLTICFEVERISLKQKEWIFTYSNNSSAMLLSLGSDGTGMKMVVDGVVCPIDNIILPS
DFTYSMKSFCVLWTSSNGRVAVYFNGNYWAKACSSSTGHSVQAGGEFRIGNQQQSFDGNI
YNLRLWDYAMSIQQLGALKCESVGNVIDWDNSYWAIPASLAQTDTSLSCSVFPVSNAPLN
TNCDSPALGCPEEQFYQFKFVVDDSRSQTTRETLKSAVALWLNQTFENWIHKVYVGNISV
QLRPETAGNLSSYECRGLLVNTDITNESLSLIDDASARLRQGSMAEGMEIQSASVEVKLI
ENCPRDSHWPETRPTVTRYQPCFLNKKWRTCLISSLNYSSYWSDPNSSNCTDIDSIQVSA
ENASDVAEQLKAFTNNKLNETEVSKVVSKVEQLVNVAKINITLASSIVTIISNVMIGSAT
VPSASDKALKTMDELVQKIQFDGPSIQINSKNLAVGILALNTTTFNKTTLGAFMSPNKSD
PQIDFNSKSEQLNPLAQVTLPASLLSNVSHAEPDTLSRISFMFFSSPSFFQKKEENELIS
YVVATSVGNFSIHNLMDPVRIEITHRSEQASENLVCVFWDFKKNDGTGGWNKEGCTKNST
YSTANKTVCECDHLTHFGVLLDISRTSASIDEKNNKILTYISNIGCGISAIFSAATLLTY
IAFEKLRRDYPSKILMNLSTSLLFLNMVFLLDSWLSTMENDGLCLAVAIFLHYFLLTSFT
WMGLESVHMYIALVKVFNTYIRRYILKFCIVGWGLPAALVGIVAVVDKGAYKAEEHKGGS
KFCWITNETVFYTTCVGYFCLVFLLNLAMFVVVMLQICGRNGKRSNRTLREEVLRNLRSA
ISLTFLLGMTWGFAFFAWGPVKLTFMYLFSIFNSLQGLFIFIFHCALKENVQKQWRRYLC
CGRFKLSDNSDWSKTATNNTKKVSSDNLGKSLSSSSFGSTTANWTSKAKATLNPFKRHSN
TAKCYSKQTNPKCISSSCSSSEVEPNSSSSSSSILPVSQMIDKVKGYCSTHSDNFCKNII
MPDTCTHCTRF
Download sequence
Identical sequences I3KRA4
ENSONIP00000023649 ENSONIP00000023649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]