SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024045 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024045
Domain Number 1 Region: 93-132,244-307
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.24e-26
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00027
Further Details:      
 
Domain Number 2 Region: 40-91
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000135
Family TS-N domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024045   Gene: ENSONIG00000019100   Transcript: ENSONIT00000024066
Sequence length 313
Comment pep:novel scaffold:Orenil1.0:GL831146.1:2748573:2753742:1 gene:ENSONIG00000019100 transcript:ENSONIT00000024066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDAKMFLTFLCRTLTRDVAKVSVGQHVQSLHTGCQLLAAEKALLMKLRKSTGYTFINCKK
ALEKFDNDVAQAETWLHEQAQKEGWSKANKLEGRKAKEGLIGVFVGDKAAVMVEVNCETD
FVARNEKFQQLVKDVTFATLAHHRNKTQSQPGYVKMLMEAEQWTSMHLGGRGPDIASYYH
VNLSHLGENMSLKRAVTVGIPAEWKIGSYVHGGISTQTEVAMGRYGALVIFQGGKEGEQE
MLGRKLGQHIVGESPLSLGNMDDLPCGESETCLLPQTFLADPSRTVAQFLRGQQARVLDF
VRFQCGETTEDAE
Download sequence
Identical sequences I3KSE9
ENSONIP00000024045 ENSONIP00000024045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]