SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024461 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024461
Domain Number 1 Region: 27-135
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 295-395
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00023
Further Details:      
 
Domain Number 3 Region: 404-516
Classification Level Classification E-value
Superfamily SRCR-like 9.02e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 4 Region: 174-273
Classification Level Classification E-value
Superfamily SRCR-like 7.46e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024461   Gene: ENSONIG00000019433   Transcript: ENSONIT00000024482
Sequence length 740
Comment pep:novel scaffold:Orenil1.0:GL831146.1:6812384:6840487:1 gene:ENSONIG00000019433 transcript:ENSONIT00000024482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLAVFCFLLYTLLVASSAQSDSNQPVIQLRLAGEKKKHYEGRVEVFYNGEWGTVCDDD
FSIYAAQVVCRELGFTGAESWSPSAKYGKGEGRIWLDNVHCTGSEKSLAHCESNGFGVSD
CKHSEDVGVVCSSKRIPGFKFIRNQANSQEGLTVQVEEVRIRATYSHRKRIPITEGFLEV
KDGGKWRQICNEDWNQKNSRVICGMQGFPGEKRFNTRPYKLLASRRKKNYWGFSINCTGN
EADLSDCKLGREIEQKGNSTCGKGMPVVVSCVPGRVFAPSVSIGFRKAYRVEQPLVRLRG
GAMIGEGRVEVLKNGEWGTVCDDNWNIRAATVVCRELGFGSAKEALTGARMGQGIGPVHM
NEVECSGFEKSLTECYFNPNSLGCSHEEDAAVKCNVPAMGFHNRLRLSGGRNPYEGRVEV
LGERNGSLVWGTVCSDSWGTMEAMVVCRQLGLGFASNAFQETWYWQGDSSADPVVMSGVR
CSGTELTLEQCLHHGKHVACPKGGGRFAAGVSCTMTAPDLVLNAQVVEQTTYLEDRPMYA
LQCAHEERCLSGSADKADPSSYRRLLRFSSQIHNNGQSDFRPRASPQSWVWHDCHRHYHS
MEVFTHYDLMSLNGTKVAEGHKASFCLEDTYCDEGIQKRYECANFGAQGITVGCWDTYRH
DIDCQWIDITDVKPGDYILQVVINPNYEVAESDYTNNIMKCRSRYDGHRIWTYNCHTGGT
LSSETEETFPGLLTNQLSHR
Download sequence
Identical sequences I3KTL5
ENSONIP00000024461 XP_003441453.1.78416 ENSONIP00000024461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]