SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024679 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024679
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily EF-hand 9.09e-37
Family Calmodulin-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024679   Gene: ENSONIG00000019602   Transcript: ENSONIT00000024700
Sequence length 195
Comment pep:novel scaffold:Orenil1.0:GL831171.1:4317609:4324554:1 gene:ENSONIG00000019602 transcript:ENSONIT00000024700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRASRLLREEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKNKNPSATEPLNSRTNKLLFAFR
LYDLDRDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADTNGDSCISFNEFIKVL
EKVDVEQKMSIRFLH
Download sequence
Identical sequences I3KU83
ENSONIP00000024679 XP_003445513.1.78416 XP_005746570.1.53837 XP_005934074.1.24487 XP_006798654.1.46954 ENSONIP00000024679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]