SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024753 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000024753
Domain Number - Region: 507-545
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00589
Family Spermadhesin, CUB domain 0.0074
Further Details:      
 
Domain Number - Region: 193-233
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0419
Family Spermadhesin, CUB domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024753   Gene: ENSONIG00000019662   Transcript: ENSONIT00000024774
Sequence length 717
Comment pep:novel scaffold:Orenil1.0:GL831250.1:108189:125699:1 gene:ENSONIG00000019662 transcript:ENSONIT00000024774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSRDPKESVCEVCTAEGPTLTCSTEKTLNNVDKLSVVFSCLKPQDGFNVKIKKTIVCI
WTDAPFSGEPVQAESSVFPEFNRTFKWDLKTDFPHTFQLDFPEQGLRQISSEEKCPDEHT
YSFIIYLRGQANIGTFCRGGSVNTIQGRYKGRVSLQVPANAKMDPFEFKLSGGPETDMIA
IVGVNLPRGVSDTTLVTANFPRDFPDSMQMQWNFTVPGMHNYTVRFDHVTPPECLNNGEV
KVDYQAGANTVTKTLKDPQPEHQQGNFNMVLTNCETNTTLPGLTLNYSVSVVRSGRPAEE
ASRMRVLCTVDLTKDPGMSLQIENLNSDSYCEISINSEVKEKINVTAGSIAKLSFLDCPN
EDVRLTAKKVIDCKNTESCPVTTLSVSTMEPCLPMPLNSFTWHLNIPETKTWDLVSPKGS
LRQSLPSQECKEPFSLHLAEEEGSNFVGNFCFDGVIQKIQVHANISITAPGQQLRRMTGS
FLNISVSEEITETIIYAVSPATMSPTLLATPNWPQGMKSYRTLSWIVMLPDQYKAQLNFN
VTQPKCKEGHTGIDVRTIGNEQPKLSFKEQDPQVVEKLVGESFYLNMSNCEPETGQFSVL
TIISLQRKQNYLPIVLGISGALLLLLIVLAVVCIVAKKKKNQKRNRGSSIYMPKGNIFRP
SDMHFTKTRSENESHVYESIDEAMVYGHLLSNSSHGEAFPDHYNGIQTDSYRTFTGP
Download sequence
Identical sequences I3KUF7
ENSONIP00000024753 ENSONIP00000024753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]