SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024830 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024830
Domain Number 1 Region: 20-152
Classification Level Classification E-value
Superfamily Cupredoxins 1.76e-49
Family Ephrin ectodomain 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024830   Gene: ENSONIG00000019727   Transcript: ENSONIT00000024851
Sequence length 227
Comment pep:novel scaffold:Orenil1.0:GL831250.1:1401804:1414407:-1 gene:ENSONIG00000019727 transcript:ENSONIT00000024851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLVWIVGFVGSVCAWCASAERHSVYWNSTNPKFQRNDYAVEVKLNDYLDIVCPHYPQGE
VPSLDAERYVLYMVEREDYDTCKPQSYDQMRWECGHPFAPHAPEKFSEKFQRFTPFTLGK
EFRQGESYYYISKPLHHHGQECLRLRVSVIAADGSQEARVAKGGTGGTTVGAGGGVHNPS
NRLPAADDPVVILPDVQKSVSTSSAVAATSLSILSVLVPFSLLFLLH
Download sequence
Identical sequences I3KUN4
ENSONIP00000024830 XP_019206487.1.78416 ENSONIP00000024830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]