SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024831 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024831
Domain Number 1 Region: 24-159
Classification Level Classification E-value
Superfamily Cupredoxins 3.04e-47
Family Ephrin ectodomain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024831   Gene: ENSONIG00000019728   Transcript: ENSONIT00000024852
Sequence length 224
Comment pep:novel scaffold:Orenil1.0:GL831250.1:1454249:1530186:-1 gene:ENSONIG00000019728 transcript:ENSONIT00000024852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALATFSLSLITLALTNLHLSRASNRHAVYWNSSNLLLRREGYTVQVSVNDYLDIYCPHY
NTSQRGTLERVVAEQYILYMVDYHGYRTCNTQKGSKRWECNRPHAPHAPIKFSEKFQRYS
AFSLGYEFNVGKEYYYISTPTHHHHGHSCLRLRVFVCCSTVSQADEDSIQTPDYTVRPNI
KIHNIDEFNPEVPKLEKSVSGSSPSRDRLLLTVAMLLVSAVLLS
Download sequence
Identical sequences I3KUN5
ENSONIP00000024831 ENSONIP00000024831 XP_004549121.1.88231 XP_005457288.1.78416 XP_005740715.1.53837 XP_005927662.1.24487 XP_006788055.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]