SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024871 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024871
Domain Number 1 Region: 10-185
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-42
Family RUN domain 0.0014
Further Details:      
 
Domain Number 2 Region: 676-766
Classification Level Classification E-value
Superfamily PX domain 4.58e-24
Family PX domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024871   Gene: ENSONIG00000019759   Transcript: ENSONIT00000024892
Sequence length 833
Comment pep:novel scaffold:Orenil1.0:GL831136.1:5525313:5663154:1 gene:ENSONIG00000019759 transcript:ENSONIT00000024892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGTQQTDTKRQNLLERLLDAVKQCQIRFGGRKEIATDSDSRVICLCAQFEAVLQHGLRK
SRGLALTAAALKQAAGFSSKTETELTFWFYVKEHLNRHELQRFYSLRQISSELGRGRAWL
RCALNEHSLERYLHTLLADRPRLGSYYEDWAFVLDEERASMLPTMAAGLNSILFAINIDN
SDLNGAVTRGGSSVSHLLKESTQGIGSLWKESTQGVSSLLREIGTATAVVPGFTPKVDGA
SDPLPVVPRSTSADSGLRKERRKKKKITNIISFDDDLDGGAEDEEDGEDDSQKIGGMRKS
HTAPAQSSVEEGIDPLEPVFSESLAQNGVSEPGIVSWVGSPHPCRTPPITAPPLPDSKSV
DNEEEEEEIYKPRAQTQEEERIPSDQVVVGSLSSVSTWSPLQVMVGHSSSDILIPVNPAD
PQSVSSVEDTAAFPVQCESAGSVGNCESSSRSQLTFNMESSPTTQPAPLSSSLSTSALPE
SMTVVELRQAIVAMMNRKDELEEQNTSLRSLLDGEMEHSAGLRQETDLLKKKLAELEERH
SAKVQALARENEVLKVQLKKYVGAVQMLKREGSQGNDALSVLRSSEEQTPIPQNKFMGDI
EELAASYERKLIEVAEMHGELIEFNERLYRSLMAKDHLIIQMRQELIDLRGPVPGDLSQT
SDDPSLSDFETAHRALINVWIPSVFLQGRAANAYHVYQVYIRILDNEWNVYRRYTEFREL
HNHLRSQFPQVDTFNFPPKKAIGNKDAKFVEERRKQLQGYLRTVMNKLIQTLPEFTASPT
KETLLSLLPFCQDTPQANDGGAKTPRSKTSSRFPRLGRRNTQEARPEPQSGDL
Download sequence
Identical sequences I3KUS5
ENSONIP00000024871 ENSONIP00000024871 XP_019218338.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]