SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024884 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024884
Domain Number 1 Region: 9-49
Classification Level Classification E-value
Superfamily UBA-like 0.000000214
Family TAP-C domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024884   Gene: ENSONIG00000019768   Transcript: ENSONIT00000024905
Sequence length 167
Comment pep:known scaffold:Orenil1.0:GL831136.1:5953804:5970105:-1 gene:ENSONIG00000019768 transcript:ENSONIT00000024905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASSKMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYGHHHQM
MCTPANTPATPPNFPDALTMFSRLKASESFNSGSGGSPMAAAMATSPPPHQVGGWGVSSN
VPNVPQPPQGLWTQGQPPTQPCPAWPTGVNPHTGAEQKASVAMEAER
Download sequence
Identical sequences I3KUT8
ENSONIP00000024884 ENSONIP00000024884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]