SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024947 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024947
Domain Number 1 Region: 241-421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-41
Family Pentraxin (pentaxin) 0.00048
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000024947
Domain Number - Region: 48-197
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0165
Family HBL-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024947   Gene: ENSONIG00000019818   Transcript: ENSONIT00000024968
Sequence length 438
Comment pep:novel scaffold:Orenil1.0:GL831136.1:6638700:6652147:1 gene:ENSONIG00000019818 transcript:ENSONIT00000024968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLLSGVLCFCALGCGQLTNRQADDGKRYICRAIPLTGDASCPVTLLPELNAGGQEEEL
RNTVMQLRETILQQKETISKQIGTINELTTKLSLCASATADRKYDKGGTWGKDKQNTMGD
VPGDPNETIDTLGKTMQGLKDRLENLEQQQMRANISGASFPSELRDLLQQRLGELEKQLL
KKVSTLEAEKSMLSNATAAYRLKTESTLNALVERINELEKGGGDFISPEQFKLSLPQRTN
YLYGRITKSLPEMYAFTLCMWIKSSASPGIGTPFSYGVPGQANEIVLIEWGNNPIELLIN
DKVAQLPLEVRDGRWHHICISWTTRDGQWEAYQDGEKLGAGDNLAAWHPIKPGGVIILGQ
EQDVVGGRFDAGQAFVGELSQVNIWDRVLKPVEIQSMANCTSYVPGNIVSWLASNVEVFG
RGAFKRPLEICQERLPNA
Download sequence
Identical sequences I3KV01
XP_003438612.1.78416 ENSONIP00000024947 ENSONIP00000024947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]