SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024954 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024954
Domain Number 1 Region: 641-759
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000173
Family Pleckstrin-homology domain (PH domain) 0.051
Further Details:      
 
Domain Number 2 Region: 218-377
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000214
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.013
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000024954
Domain Number - Region: 1015-1089
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0105
Family Regulator of chromosome condensation RCC1 0.034
Further Details:      
 
Domain Number - Region: 820-841
Classification Level Classification E-value
Superfamily Chondroitin AC/alginate lyase 0.0751
Family Hyaluronate lyase-like catalytic, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024954   Gene: ENSONIG00000019824   Transcript: ENSONIT00000024975
Sequence length 1209
Comment pep:novel scaffold:Orenil1.0:GL831136.1:6690882:6706370:1 gene:ENSONIG00000019824 transcript:ENSONIT00000024975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSLLWAVDVYGRVYGLSTVGQQWDQCRDAQMEFKRVTAAQECCWGIACDNNIYLNVHA
SDLSIRYQEETYENQRWNPVDGFSERLLPSDRWQWSDVTGLQHQPLDSFQLPSSSWEWEG
DWYVDENFEGEPTEKGGWTYAIDFPATYTKDKKWNSCVRRRRWLRYRRYKAMDTWAKIPS
QHTTLPDPFSDISCGGWEISEEPRGRLSLWAVSLQGKVWFREGIYHQNPEGASWEEVLLP
GEVVQISCGPADLVWAVLWEGQLIVREGISRDCPKGASWAIVESPSSDVGATHVAVGNNV
VWVVTKDNKVWFRRGVNSHNPCGSGWISMVGEMIMINVGQNDQVWAISSEDRAVYFRQGV
TSSELSGKTWKAITVPRDRDRSQSSASANSLQSAGCFFCGEVRAPSVASDAESDLEKGSA
DGPGCLVTSTSPDTFVDAPSDPPADTPKPRIPKVTSDSFISELVSDRESGKTSRDVGKAT
PTVLEEDTISHEGDAKAPCAGVALSPSQSGGPLDTQWSNVDLEEAQSQQAQTGAVLDSAD
TCSLSSVATYTLAMEDPYGGDEHPLWAWVSGGGCSVDSHSQLSWFNSVNTASLVQSVQSM
SLSVSPAQTAAWRKQIFEQLSERTRREIDNFKHYEQAIEQSVWVKKGSMQWWRDWKPHKW
IDVHFALEQFSGPEGNKDGILFIYYNYYEEKKYLHAFINEVTILVPVLNDSKHTFAIYTP
ERTKQRWPIRLAAATELEMHDWLALLSVSCCDSRGIQGPPSKQAIWSITCKGDIFVSEPS
PGIEAVPYPTPCDQMFWRQVGGHLRIVECNSVGIVWGIGFDHTAWIYTGGYGGGLFQGLA
SSTDNIYTQTDVKSVYIYENQRWNPVTGYTNRGLPTDRYMWSDASGLHECTRANTKPPSP
QWTWVSEWAIDYSVSGGTDREGWQYAADFPASYHGYKTMKDFVRRRRWARKCKLTTTGPW
QEVPPIALSDVTILPCAAQSTVDMVPVWAISNKGDVLCRLGVTALTPAGSSWLHVGTDQP
FKSISIGAASQVWAIARDGSAFYRGSVSPQNPAGDCWYHIPSPAKQKLKQVSVGRTSVFT
VDENGNLWYRQGVTPSYPQGSSWEHVSNNVRKVSVGPLDQVWIIADKVQGSHSLSCGTVC
HRLAVQPMQPKGQSWDYGIGGGWDHITVRGNSVEPPHIRLPSLTDMSTSSPRSLLEVRNT
EVDSGTSGC
Download sequence
Identical sequences I3KV08
XP_005448187.1.78416 ENSONIP00000024954 ENSONIP00000024954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]