SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025091 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025091
Domain Number 1 Region: 29-127
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.7e-32
Family Cap-Gly domain 0.0000257
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000025091
Domain Number - Region: 958-1067
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000732
Family Hemolysin E (HlyE, ClyA, SheA) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025091   Gene: ENSONIG00000019920   Transcript: ENSONIT00000025112
Sequence length 1285
Comment pep:novel scaffold:Orenil1.0:GL831388.1:867702:878786:1 gene:ENSONIG00000019920 transcript:ENSONIT00000025112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNRRHSYTPRLTSPLISKMSSTGTVESSKPPKIGSIVEVTGKGQRGTVAYIGATLFAS
GKWVGVILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQIQVVEDGSSATSPDTPESGTT
KTLKQKVTHQRSDTVSMITLWQWNTPRLTSATSLPSLLVRPSSRSSLSVTASRESLASSL
SGDVSEAGLSSQQGALGAPVIPQPSGSPAAAAASVPATPSKEEESLRAQVKDLEEKLETL
KMKRTEDKAKLKELEKHKIQLEQLQEWKTKMQEQQGELQKQLKEAKKEAREAQEAKERYM
EEMSDTADAIEMATLDKEMAEERAESLQVEVDTLKEKVEELSMDLEILRHEISEKAGSDG
AASSYQVKQLEEQNSRLKEALVRMRDLSASEKQEHVKLQKQTEKKNVELETLRTQKEKLQ
EELKQAEATIDELKEQVDAALGSEEMVETLTERNLDLEEKVRELRETVTDLESINEMNDE
LQENARETEMELREQLDLSGAKVREAEKRVEAAQETVADYQQTINKYRELTASLQEANRE
LISQQNANAEQVQQPPAELFDFKIKFAETKAYAKAIEMELRKMEVAQSNRQVSLLTSFMP
DSFLRHGGDHDCILVLLLIPRLICKAELISKQAQEKFDLNGNPVQGTGLRGPPGEQRSFA
SGLVYSLSLLQATLHKYEQALNTCSVDVFKRMGTLYSEMSFHERSLDYFIDLLHKDQLDE
TVQVEPLTKAIKYYQQLYSVHLADHTEDCTVQLADHIKFTQSALDCMVVEVARLRAFLSS
GQESSGLAVLLKDLDTSCSDIRQFCKKIRRRMPGTDVAGVPAAVSFGPEVSETLTECRRQ
LTRVVAVLQEVAAAGAQMVPSLGEQEGLNALKLEDIACKVVEQVYGSHGVNGPELLRQSC
SSVITTMNKMATAMQEGEYDAEKPQGKTLPVEMRAATVRAEMTDAEGLGVKLEDRETVIK
ELKKSLKIKGEELSEAHVRLSLLEKKLDTSTKDADERVEKIQTKLDENLALLKKKEKEFE
ETMDALQADIDQLEAEKAELKQRLSNQSKMTIEGLRGPPASGIASIVQGSGGESFYFSPS
GLPPSMGGPMQVVDSPLLRQQIEAQRLGIKHLKNENNRLKAEKMRAQLASLPPLRPPKLP
QVSKESSMPPEGLNTGIYRRTDQLLATLLKLSAEVKVVDITGKTAVSASAQLLEQTARLQ
NLSDALDKLKGEVAEHVVSHQPGAKASSDFATFPVTSFTKAKEEKQGDTVFIGRVAIPCT
RGQEQVHRLVLSKPQLQQVHSLLMV
Download sequence
Identical sequences I3KVE5
ENSONIP00000025091 ENSONIP00000025091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]