SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025124 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025124
Domain Number 1 Region: 934-995
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000596
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000025124
Domain Number - Region: 308-420
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000392
Family HBL-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025124   Gene: ENSONIG00000019949   Transcript: ENSONIT00000025145
Sequence length 1005
Comment pep:novel scaffold:Orenil1.0:GL831136.1:7961184:7974062:-1 gene:ENSONIG00000019949 transcript:ENSONIT00000025145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGAGGGKRPPGGDSPPGPPEKKSKKEEKTTTTLIEPIRIAGVSSTEEMDMKVLQFKNKK
LCERLEQRQAMEDELREKIEKLEKRQATDDTTLLIVNRYWSQLEENVRILRKRIEPDPPV
VSTPAPPSATIPDQTPMEEDSVNLASPSGVPPPPVPEAQNEGERPEQQQEERQEERQEEE
QQQPPPPTGSDDLLTPSESQSDSKTDTSPPPPPLSENAKGFLSTLEQSSEEELTLHLQDR
MQFSKEAIACLVCVFDRLHSHISDMCKVVQAAGFEDDGQSDIINLNCTLLDENTRLRDLA
TLLQGRHHKMSMEYNELVDKVTSSETKVTEMETTVEDLQWDIEKLRNREQKLNKHLAEAM
EQLKSGYSSTGSSGGLAGGQITLNIQKFESLNAELEHNQELANSRMAELEKLQVELQEAV
RESEKLKMDLRNIPEEVVKETLEYKCLQSQFSLLYNESLGVKTQLDEARALLLTAKNAHL
RQIEHMESDELSLQKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQNLAANEQAGPINREMR
HLISSLQNHNLQLKGDVQRYKRKLRETQLEINKLRCQSGDTGVLILEETTSDSIDVKKEE
DDDQEEEEERRRELERQRAREREREREREAERERERERERERQRSDELKRKDSDTLKMLR
VELKKAQESQKEMKLLLDMYKSAPKEQRDKVQLMAAERKSKAEVDELRMRVRELEERERK
ESKKLADEDALRKIRVAEETIEHLQKKLAATKQEEEALLSEMDVTGQAFEDMQEQNSRLL
QQLREKDDANFKLMSERIKSNQIYKLLKEEKEELADQVLAFKTQVDAQLLVVQKLEEKEG
VLQSTLAALEKELAVRTQALELNKRKAVEAAQLAEDLKVQLEHTQAKLKEIQVSVAENRT
ARERESSNLKRAQEDLSRLRRKLEKQKKVEMYSDADEILQEEINQYKAKLRCPCCNTRDK
ETVLTKCFHVFCYECLKMRYDTRQRKCPKCNCAFGANDFHRIYIT
Download sequence
Identical sequences I3KVH8
ENSONIP00000025124 ENSONIP00000025124 XP_013128448.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]