SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025392 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000025392
Domain Number - Region: 726-838
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.00144
Family PspA lactotransferrin-binding region 0.0017
Further Details:      
 
Domain Number - Region: 846-952
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00785
Family HBL-like 0.04
Further Details:      
 
Domain Number - Region: 1062-1228
Classification Level Classification E-value
Superfamily Tropomyosin 0.0209
Family Tropomyosin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025392   Gene: ENSONIG00000020153   Transcript: ENSONIT00000025413
Sequence length 1271
Comment pep:novel scaffold:Orenil1.0:GL831260.1:1291212:1311208:1 gene:ENSONIG00000020153 transcript:ENSONIT00000025413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVDIYDSQYLLILAPSLVIALMFLFFWLFMKETSYDEVLAKQKRDLKLPPSKPDPRKKN
EKKKSKKKESSSGGSGGGTGGGGESEEDLRDFDVAEGANSSTVEVEEETVSAATPDPAPP
TPTPYVPVSVSSEAPAGLRERKKKEKKAAKAAAAAAAAAAATVSPSEEPEVNGSKPVSRK
TEAPLAASKQSSTPSPKHEVQVQIQAVQAPVQAQTPPQISGKKKEKKKQKVESADEQHTE
VKVEQAPATVKKEAPIVAETKALDGATQSVTSGKKKNSAKKQKTDHVDEAHILPDSAASA
NHQAAHNDDAPSKGSGKKQKNETDKENTEVKLKELLSGLSSLALSDAEAVSVMALLREKS
PNAVDAWHKSSTRPDPTAQEREKLLTTLQEEASIAKDKVKQLSQELQVEKQKTNRVESVM
REQRAAMEKELGSMQGKAQGTYQELQTMQIKFQQVREQLEGQISRLQQENGILRDAVSSA
TNQMESKNSAELNKLRSEYAGLMKELSDSNSKLQQEEHQRKSLEVSYKQNVSQLEAQLQD
AKRRWEELQNFIHSVNAEREKLQTSKQELHNQLLAVEAEMSNKNKEIQTLHSSLTEAVVS
KDRLEQKVRELMEMSKHSMQDDSLQARVQELMNENKSLQVQISTQATHVSHIEELQKLLA
EKELQRKSLEDSLNAERSSGASRETNMQALHNENMSLKAEIQNLQAQISDQTASQLALDQ
FQKSVREKEENMKTVEGLLEKGLIEVANKEEELKTAREENGSLKQEIEDLKKKMDKQVSS
ELMVEELQSKIQEKETKLKMVEESLQAAQDSSSAREKTVEALEQQLAALQAEIEQLRQKE
TAEVLTSSATQLQELQAQLVGKDQEIQTLQSELEARTKELSEKIQQVQQQQSHTVVPSPE
LLTALSEKEKQVSDLQAELAELRDTVNLQRKKNDELREKNWSAMEALSATESMLQGKLSK
AVKENQTVLAVCQAECRDVLHRLLPHVPLPSEQNHQEWLQRFERAAGENSASQSSPGSGD
SEELAEKLKEAEETQRVLQKDCETYKKVLAETEGILQRLQNSVEQEESRWRVKLELSQAE
LGQMSQKVAALEQEVERLTDEAELENLRREKQHLESELERAERESATYVTEVRELKDLLT
ELQTRLDGSYTEAIRQNEELTLLKTQLTETLSKLEAEESERQKVAGDLYKAQQSVDLIQG
ELSKVTDNADDLIENSSLSSQREEIDRKEKLTAGLGQTVTELQQLLQTVSRQLTKRQEGE
ADKDLPKAASN
Download sequence
Identical sequences I3KW96
ENSONIP00000025392 ENSONIP00000025392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]