SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025427 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025427
Domain Number 1 Region: 40-336
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.75e-81
Family Protein kinases, catalytic subunit 0.00000731
Further Details:      
 
Domain Number 2 Region: 331-716
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.32e-80
Family Regulator of chromosome condensation RCC1 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025427   Gene: ENSONIG00000020182   Transcript: ENSONIT00000025448
Sequence length 844
Comment pep:novel scaffold:Orenil1.0:GL831260.1:1865183:1871292:1 gene:ENSONIG00000020182 transcript:ENSONIT00000025448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLEGYERHLDSISSDLSSGSVVSERAALAPFNGEEEKLHYIPIRILGRGAFGEATLYRR
TEDNCLVVWKEVELNSLSDKERRDVMNEISILSILEHKNIIAYFNHFMDKNTLLIELEYC
NGGNLYDKIVQQKGTLFSEEVVIWYLYQITSAVAHIHKAGILHRDIKTLNIFLTKTDLIK
LGDYGLAKKLGSEFSMAESCVGTPYYMSPELCQGAKYNFKSDIWAMGCVLFELLTLTRTF
DATNPLNLCVKIVQGNWTMELNSDIYSSAIVKLVHECLDQDPAKRPTAEQILDQPLISSC
RQELEERVCLLNSAMKKPKLSTVSESPVAVVTQRSRDVYYWGGGKFTPQKLDTFKAGSSA
QYVCAGENHFAVVSVEKELYTWANVQGGAKMVGQLGHGDQASYRQPKKVEKLIGKAIRQV
ACGADFTACVTDEDQMYMFGSDYYGCIGVEGELGMEILEPVLLEFFEERPVRQVSCGDNH
VVVLTQNGDIYSWGVGEYGRLGLECEDDFNSPMQVEIPKGATISSVSCGSDGTFFLTEMG
KVLACGNNEFNKLGLTQGFSGIKNHPGESYQGIPYITTLTLVKQLSRFKIRTIAPGKTHT
AAIDERGRLITFGCNKYGQLGVKDFKKHQCVQVLVGPFGGKIVTKVSCGDGFTIAATEAD
NQIFAWGNAGNGRLGMPADKGFGSEVCPAMPRPIFGSLHHVPDLSCRGWHTIIIMEKVLN
SKTIRSNSSGLSTDRGLAHEESPSTSMDLDIEPGAETECRDRGLGGTMEVNTEDCFLETP
MMSMANQTGDSSCPLWLRKELEDAEFIPIPDNSEPLTPDQLSSFSKSVTLPYEELKELKA
AAAA
Download sequence
Identical sequences I3KWD1
ENSONIP00000025427 ENSONIP00000025427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]