SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025623 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025623
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily CAD & PB1 domains 8.24e-34
Family CAD domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025623   Gene: ENSONIG00000020333   Transcript: ENSONIT00000025644
Sequence length 257
Comment pep:novel scaffold:Orenil1.0:GL831152.1:4137060:4142449:-1 gene:ENSONIG00000020333 transcript:ENSONIT00000025644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYAMRSLSLFTPSNLSKCVTASMSASASMTQQLLSGRVPRPKPFRVLNADRSVKKGIMA
DTLEDLTNKASDSLSILCISALVLDEDGTGVDTEEFFQTLPENAVLMALEKGQKWSPHPY
NTYRDCLSDCRQQQQRRDVAKLTFDLYKNNPKDFIGCLNVKATLYGVYTVSYDLRCYAAK
KMLKEALRWTIFSMQATGHILLGSSCYIEQLLEEKERAEKSLALPLEEERAEKSLALPQE
GRIRQLQNMLLGKISYL
Download sequence
Identical sequences I3KWX7
ENSONIP00000025623 ENSONIP00000025623 XP_003442798.1.78416 XP_005450294.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]