SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025688 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025688
Domain Number 1 Region: 372-422
Classification Level Classification E-value
Superfamily UBA-like 0.000000000442
Family UBA domain 0.0009
Further Details:      
 
Domain Number 2 Region: 454-490
Classification Level Classification E-value
Superfamily UBA-like 0.00000766
Family UBA domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025688   Gene: ENSONIG00000020385   Transcript: ENSONIT00000025709
Sequence length 494
Comment pep:novel scaffold:Orenil1.0:GL831152.1:5982110:5985066:1 gene:ENSONIG00000020385 transcript:ENSONIT00000025709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARKSGSVWTGPISYLDDVPFKINDKFRCPAKVGLPVGFSLPDFGSVLADTKYDFSLEK
RSVRWGAEQAEAIAAEARAEEAAAKQEAESRKRLAKAQEVDGGGGKKPQSPAEDQDLPPP
ALNPVLAGLSHNAILTPLPAPSFDHRNTQPSTPQLHSLNLADFEREEDPFDKLELKTLDD
KEELRNILQSQPQPQAQPQPQHPPSVSPPEISQLGPTSRGNSPSPPSINTSLSSKPGFAH
KPNGLVAFLDMDRVGHPGRAAFDTDDRPCNIRSLTFPKLSDSGDPEPLRYTPLPTTVPAP
RQNLPNGSSPTIPKAEVIVAPELASHTKSGTPKPKTAELKIKKMPKLCFVSGPKTIHCVR
ADCGRSGSAGLPCGGALLSMTPNERQCVETLVGMGYSYEGVLRAMQRQGQNMEQVLDYLF
VHGRLCERGFDESAVEECLEMYQCSEEKALQFLELMSRFGEMGFERDTIKEVLLVHNNDQ
DKALEDLMARATAS
Download sequence
Identical sequences I3KX42
ENSONIP00000025688 ENSONIP00000025688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]