SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025691 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025691
Domain Number 1 Region: 23-106
Classification Level Classification E-value
Superfamily UBA-like 3.4e-28
Family UBA domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025691   Gene: ENSONIG00000020387   Transcript: ENSONIT00000025712
Sequence length 1256
Comment pep:novel scaffold:Orenil1.0:GL831152.1:6004747:6016898:1 gene:ENSONIG00000020387 transcript:ENSONIT00000025712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSSLGGDKARGPREKALPASAHTSQPQKQIQATAEQIRLAQMIYDKNDADFEGKVNQLM
EVTGKNQDECMVALHDCNEDVSRAINFLLESNTDMTSWETVGKKKPLVKEGPSESKENKE
NREKKGEREASKGRATGNRKGKGASRSRQARPEENGVEVTPVDKGSDRGRRVKGGRGSGV
RGRGRAPTGSRFSAQGMGTFNPADYTSEAGTGTTQTEVWDTTTNNSTDGTVAWRNTLEDW
AAEDWSEDVSLSETKVFTSSCAPAAENHITPGQSLDLASLLQKPVVGAREPPSSSSQSLV
FTNSHHHQQQPHSRSATSSTSYAHAALSSVLGAGFGDLGQAKRTQANPGVQILEQLKGPG
LGQLSSSQATPPVSTQGSNTSIGRLPGLGAPVPPPSSSSWEMKTSESNTTSLSSQYSREF
GLQPEPSLVLSQLVQRHTGPSLPLARQTSPQSQQQAPSASASPAPQHTSTPAQAGPVMAP
AGAKPLAPNAGLDPQGNSTTQQQRAQLKGQKRRIPPTSKIPSTAVEMPGSADVPGLNLQF
GALDFGSESALPEFGVVDNCVSAASRESASAPASAPPATGPGAQSQTSLYSKPLSESLGS
PLSVALSLPLSSSEPVYHSSTVALPSHTSSSLGTASSTNTPSSSSTTSTTSASVPSSSPF
STVGGSYDGTMPPHTRLAFSQNKEATGPVMNGLNGVRTSAALDTSSASSTPKPESPSMNI
STNGASAPSSHLPSTLPPHSSTTLSGLAADLPSVSQLNSLNSHVSSHSSVSALGSSSHTY
TSVDSSNVSSLAPSSGSYTSSQPTASALHSAHNSSNSSSSISHLSNMPSMGNNMSSTVGG
IAGTSGLHSAATATSSTVLGLGSNGATATSNLSAPRTTPLLSSSTGKAPPNLSQGVPPLL
PNQYIMGPGGLLPAYPQIYGYEDLHMLQSRLPMPSLQDYYGITFPGPAATLSGRDGSLAN
NPYSGEVTKFGRNDSTSPAPPTSLAAPQPPQAQSQGQNQAQPQPPQAQPQPQGQPQHHSS
QQAFLPPGYSYTGLPYYPGVPGAVPSAATFQYGPTMFVPPGGPGPASAKQHSMGLGLGNP
SASPFQQQTQQQPSGYGQHTFSSGYEELTAGPAGVEYSKGYNSSSQAQAKSAATGPGKGV
SVTSSNSGVPDISGSVYNKTQSFDKQGFHAGTPPPFSLPSALGGPGPLNPGAAPGGYAPA
PFLHILPHQQPHSQLLHHHLAQDGQGGPSQRGQSSSLQQKSQVNKSSYGSSPYWAN
Download sequence
Identical sequences I3KX45
ENSONIP00000025691 ENSONIP00000025691 XP_013125416.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]