SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026069 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000026069
Domain Number - Region: 12-66
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0383
Family PB1 domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026069   Gene: ENSONIG00000020764   Transcript: ENSONIT00000026090
Sequence length 281
Comment pep:novel scaffold:Orenil1.0:AERX01075446.2:786:1628:1 gene:ENSONIG00000020764 transcript:ENSONIT00000026090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSQKFLLRVHVTTDVAVKVSLTKRPESVEELITILREKLNPRLDFEFTLQYEDPDFDG
QLTCLLDIQELPEKGTLKVVRSESDVSSCASSDTDILPHVPLAQRLKCWPDTFPVPTFSY
EVEHLLEEGNRAFEMSGKHLRLTRAQKHNILETMASVMHTFKAYPSDRDVSLAAEALVTT
HPCLKEPGSTNGSYGWKTSLKFKMGNYRTKLARSGCVEVSVNAGRRSVNNPEREHPHSNI
KRARRAEVNYLPNFPRGEDQVSLEDMRVQIKNEVEKTEPNK
Download sequence
Identical sequences I3KY73
ENSONIP00000026069 ENSONIP00000026069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]