SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026212 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026212
Domain Number 1 Region: 299-474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-50
Family SPRY domain 0.00011
Further Details:      
 
Domain Number 2 Region: 11-78
Classification Level Classification E-value
Superfamily RING/U-box 2.08e-18
Family RING finger domain, C3HC4 0.0073
Further Details:      
 
Domain Number 3 Region: 98-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000794
Family B-box zinc-binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000026212
Domain Number - Region: 135-248
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0248
Family HBL-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026212   Gene: ENSONIG00000020909   Transcript: ENSONIT00000026235
Sequence length 476
Comment pep:novel scaffold:Orenil1.0:GL831164.1:72377:73804:-1 gene:ENSONIG00000020909 transcript:ENSONIT00000026235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKDQMAERALFQNFLSCHVCSETFRDPVSLSCNHSFCSSCLQKFWEQTKNKNCPICKRKS
SKDRPHVNFTLKELADSFAGRQKSGSSETEKREKKLVVVCSKHEEVPKLFCVDEQRAVCP
VCDFSLHQSHKVVPVEEAVSDLKEQLKSDLKSLQDKRNKYKQVEETYNEVIQHSKKQLLS
TERQIRAEFNKLQQFLKEEEESRLAALREEEEQKGRTISREMKMIEEQISSLSDSISAVE
EELQKHSVSFLSSYKDTQSRARAQSSVSDPQLVSGALIDVAKHLGNLSFRVWEKMKEKVH
FSPVILDPNTANPRLYLSDDLTSVKHGGQTWQQLPNNPERNTKYATVFGSEGFSSGKHSW
EVEVRDHPVWLVGLVKETVDRKEERSALPKYGNWCLKHSSGKYTDVVGQTVTVKKSLQRI
RVQLDYDRGEVSFYDAEDMTHIYTHRDTFIEKLFPYFNIGNAGDAKTSDIKICQTE
Download sequence
Identical sequences I3KYL5
ENSONIP00000026212 ENSONIP00000026212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]