SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026757 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026757
Domain Number 1 Region: 378-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.81e-53
Family SPRY domain 0.00058
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 5.74e-21
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 143-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.77e-16
Family B-box zinc-binding domain 0.00088
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000026757
Domain Number - Region: 180-312
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00366
Family BAR domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026757   Gene: ENSONIG00000021455   Transcript: ENSONIT00000026781
Sequence length 556
Comment pep:novel scaffold:Orenil1.0:GL831421.1:216189:217856:-1 gene:ENSONIG00000021455 transcript:ENSONIT00000026781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGVQLDRETFSCSICLDLLKDPVTTACGHSYCRNCIKSHFDEEDRKGIHSCPQCRKT
FTPRPVLEKNMMLAALVEQLKKTGLQAAPADHCYAGPEDVACDVCTGRKLKAIKSCLVCL
ISYCEKHLQPHYDAAPLKKHKLVAPSKKLQENICSRHDEVMKIFCRTDQQSICYLCTVDE
HKDHETVPAAAERTEKQKELEVRRLNIQQRIQEREKDVKLLQQEVEAINGSADKTVEDSE
KMFTELIRLIQKRSSDVKQQVRSQQETEVSRVKELQEKLEQEIAELKRKDGELEQLSHTE
DHNQFIHNYPSLSALSESTHSSSINIRPLRYFEDVTAAVSETRDILQDILREEWTNISLT
VIEVDVLLSPPEPKTRAGFLKYSHQITLDPNTAYTHLLLSEGKRKVIFMNQLQSYSDHPD
RFTVYYQVLSRESLTGRCYWEVEWRGRGVGVAVTYKNISRAGWGDECVFGFNEKSWSLRC
DTNSYKFWHNSIHTDLSGPRSSRVGVYLDHSAGILSFYSVSETMTLLHRVQTTFTQPLYA
GLCLYGLGATAELIKV
Download sequence
Identical sequences I3L060
ENSONIP00000026757 ENSONIP00000026757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]