SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000047 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000047
Domain Number 1 Region: 144-451
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-98
Family Protein kinases, catalytic subunit 0.0000000000981
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-22
Family Pleckstrin-homology domain (PH domain) 0.0000047
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000000047
Domain Number - Region: 96-141
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0675
Family TrmB middle domain-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000047   Gene: ENSONIG00000000038   Transcript: ENSONIT00000000047
Sequence length 479
Comment pep:novel scaffold:Orenil1.0:GL831280.1:55936:74118:-1 gene:ENSONIG00000000038 transcript:ENSONIT00000000047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDSDLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVAESLAKQEEEGILCS
PTSQIENVNEEEMDTSISHYKRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDT
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFGTIDWQDVYDKKLVP
PFQPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADNERRPHFPQFSYSASGRE
Download sequence
Identical sequences I3ITV8
ENSONIP00000000047 XP_003454185.1.78416 XP_004562250.1.88231 XP_005458685.1.78416 XP_005751721.1.53837 XP_005944073.1.24487 XP_008283188.1.38333 XP_013132307.1.78416 ENSONIP00000000047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]