SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000080 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000080
Domain Number 1 Region: 110-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-40
Family DBL homology domain (DH-domain) 0.00058
Further Details:      
 
Domain Number 2 Region: 347-532
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.25e-25
Family BAR domain 0.019
Further Details:      
 
Domain Number 3 Region: 679-755
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-17
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 582-664
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000158
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000080   Gene: ENSONIG00000000067   Transcript: ENSONIT00000000080
Sequence length 768
Comment pep:novel scaffold:Orenil1.0:GL831451.1:162535:171664:-1 gene:ENSONIG00000000067 transcript:ENSONIT00000000080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPRRLSFPLVLPKPASSARSPLGAAGQTAGSSKDQTGGEKFISEEETPESGVIVVVEA
PPEDGKAARRFSSQDSFSEESSLSEERLEEEAREAQRRAEEEEEAAAKERAAQRQQLAIQ
ELVESERSYLRLLQLSTVTIRSNLQQQLQPPPAGLDSMFLHVEEVIDVSSRLLSLLDQKQ
LQPGEPDFLQSLCDSFLSLSSEIEAAYKEYLAHYNHVTEVENSYKQKEALWNEVVRVIKA
AAPDVNATSLSFFLVMPVQRIARYPLLLQTIQKHTDASHPAYALLEQTAHTSVALNCRIN
EYKRFREVADKYRKMEMLTIKDKIVRLNTHSIAKKTARLGQQIKHEAGLKPKLVDEEFDA
LEGFFYVLENGILELLENVEMYLQHLQGFLSCRTEDFDLDMDGEKAPICYKEITTALRQW
ILPMFEKRMRKLIHQPLCALRDLLVGPRNLIRKRLDKLLDYEVIEGKPNLSYEEQAVANT
YRTLNTLLLTELPQFNGLALQMMWSTLGTFSCLHRDLAADMEQLFHSFAQQLPHSSLSPG
AFWEWAESSVLEGARRLQHLCRMLEDKLNAPDAQPLSPSSQRRLKQLTHKHGSGKIFQVM
STVVGTRDLDLNLTKGELVAVISEADSRGDRRRWLVDAGGKRGYAAASKLIRYHQPTDDP
PPSPHPSLAEDVTARRRHSYSPAGNAPLPMSQPCFQVVGAYDFTARSKHEVSFRAGEPVR
VLEPHDKRGSPEWSLVEVRGGQRGYVPSTYLAIIPMGAGLPPNPGFFL
Download sequence
Identical sequences I3ITZ1
XP_005463845.1.78416 XP_005463846.1.78416 XP_005463850.1.78416 XP_013121905.1.78416 XP_013121906.1.78416 XP_019202320.1.78416 XP_019202322.1.78416 XP_019202328.1.78416 XP_019202333.1.78416 XP_019202335.1.78416 XP_019202341.1.78416 XP_019202348.1.78416 ENSONIP00000000080 ENSONIP00000000080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]