SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000187 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000187
Domain Number 1 Region: 231-380
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.08e-25
Family DnaQ-like 3'-5' exonuclease 0.00086
Further Details:      
 
Domain Number 2 Region: 495-581,638-702
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.24e-16
Family Canonical RBD 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000000187
Domain Number - Region: 115-195
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 0.00507
Family GAPDH-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000187   Gene: ENSONIG00000000148   Transcript: ENSONIT00000000186
Sequence length 792
Comment pep:novel scaffold:Orenil1.0:GL831395.1:94750:106347:1 gene:ENSONIG00000000148 transcript:ENSONIT00000000186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVNIIGWNMESSTVAKCKAKKRKNSTHTAQEEAKRFKTEQRDDEVLQCGPAPCLPRVSV
LPDRLQQPIALDELTELLQYAALGKTGGIKKPSWCRLRHHRKVKGVNVVIVEDLTQNHFY
KHYLCLQHLRTSYTSRVTFTPSSVDVVSGIFSSQVPKQDGLTVSKADEELQEAMKNHPII
TVFGTERRGLTAYVLTEKEMIKNNYPVKGMPGFEEFVCTDCADCVTDSSPLFGIDCEMCV
TEDGKELTRVSMVDGDGKCLMDELVKPPNHILNYCTKFSGITPAMLQPITTTLQDVQEML
IRILPHDAVLVGHSLEHDLIALKLIHKHVIDTSLLYKRECGGRFKLKVLTGIILKRKIQT
EDMLGHHPTEDALAALELAQYFIKTGPRQVLEIHWKALWRETETREEPPETHRFSDVLQA
LGCSVAFLGKDSDIALKESSHKQCNSDKEVLKSFRNLKTRPSFSVLQFSTLSNHLKSYFP
HQERHHQMTCSRLQDMCVVLAGPFPTGFSDGDVKQLFSFCGTVRKVTMLNTVVRVHAEIE
FELLEGAMLAVKTLNGLNVLGQTIKVQRPVCESMLDLDVTLEALMGDPLNASHLYAVKMN
HSMTECISTSTKVNGHVSDAECLDVTPVKTVNGLPPAKVNKWLHLNTSKSELSEESVKET
FGHFGTVKRVIVSAKPKESTGHARIVFVNSEDRRAALNSSEDLWKKKYLICPSLTPVHLP
SWVGAENKKTTHSHSSAQEQQMDVVMRKLDRCLQKLFTSLPAGTLSVVVLLGHASTNGHF
PGLCLMEVKQDC
Download sequence
Identical sequences I3IU97
ENSONIP00000000187 XP_019215779.1.78416 ENSONIP00000000187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]