SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000395 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000395
Domain Number 1 Region: 367-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-61
Family SPRY domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 14-83
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-19
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Domain Number 3 Region: 151-215
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000458
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000395   Gene: ENSONIG00000000313   Transcript: ENSONIT00000000394
Sequence length 569
Comment pep:novel scaffold:Orenil1.0:GL831457.1:251052:259106:-1 gene:ENSONIG00000000313 transcript:ENSONIT00000000394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTQTVTNMASVPLENQFRCCICLDTYTDPVSIPCGHNFCLDCIEGYWDTKDRSECPLCK
ETFKERPELRINRAFSDMIEFFKRSLSPTLMQGEDVEPAHQLSDREDVPCDVCHGNKAPS
VKSCLVCQASYCEIHLVPHQRDPALQRHRLTDPAIFNTSHLCRKHNKPLTMFCKQDHTPV
CSKCTEGDHKHHKIVPMEKESRRVKMNLRETKSDIQQMIQARLKKMEDIKSSVDLSKRAT
EREIQSSSQVCSTLITAIERQQAELAKDLEERQLEAERKAEELLEELEKEIHELQTRSSE
LQHLELTRSSLHLLQSFPSLSRLPATREWSEVAVHSDNSAGMVRRAVSMLGDMCQEVANK
LSAEEVDKISAYAVNVTLDPETASGWLVLSPDKKKVSLASQKKKTPLPDSPQRFDSCVCI
LGKQSFTSGRRYWVVQVGDKTDWDLGVAQESINRKGAITVRPENGYWAICRRKGGSLSAC
AGPSVTLNLHEIPKKVSIFLNYEEGSVSFYDAEAKTHIYTYGGCSFSEPLFPYFNPCVQN
SGRNVAPLVICPLEGDVREEQDTGIDLTV
Download sequence
Identical sequences I3IUV5
ENSONIP00000000395 ENSONIP00000000395 XP_003458820.2.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]