SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001040 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001040
Domain Number 1 Region: 74-281
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-56
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 265-397
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-29
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 
Domain Number 3 Region: 470-640
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-21
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001040   Gene: ENSONIG00000000817   Transcript: ENSONIT00000001039
Sequence length 647
Comment pep:novel scaffold:Orenil1.0:GL831387.1:635279:645591:1 gene:ENSONIG00000000817 transcript:ENSONIT00000001039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLANRDSGIDSISSPSHSEELCFAGVDDGDSPAHPRMLGREEGDSDLEEEEAELTLVLAP
PKTDRQDSAELSVQQRVFNIANELLHTEIAYVSKLHLLDQVFCARLLEEARSRSSFPCDV
VLGIFSNICSIYCFHQQFLLPALQKRMEEWDLNPRIGDILQKLAPFLKMYGEYVKNFDRA
MELVNIWMERSTQFKTIVQEIQREERCGNLTLQHHMLEPVQRIPRYELLLKDYLHRLPED
APDYRDAQKSLELIATAAEHSNAAIRKMERMRKLLKVYELLGGEEDIVNPTNELIKEGHI
LKLSNKNGTTQDRYLILFNDRLLYCVPKLRLIGQKYSVRARIDVDGMELKETSSVAVART
FLVSGKQRSLELQARTEEEKKDWIQAIQATIQRHEQTMESFRHLNCSLRDDDSTPPHSPV
TQTLSCDSYSPFSASQSCAELGKRAPTPIREKEVTLCMKCQEPFNSITKRRHHCKACGHV
VCGKCSEFRARLSYDNNRTNRVCIDCYATLVGVSPSPVGLTSSSHRRRSILEKQASLAAE
NSVICSFLHHMEKGGGRGWQKAWFVIPENEPLVLYIYGAPQDVKAQRSVPLIGFEVSLPE
SCDRLERRHAFKISQSHLTLYFSADGEELQRRWMDILSRAGRGEELQ
Download sequence
Identical sequences I3IWQ0
ENSONIP00000001040 ENSONIP00000001040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]