SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001408 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001408
Domain Number 1 Region: 484-737
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-47
Family YWTD domain 0.0000101
Further Details:      
 
Domain Number 2 Region: 50-309
Classification Level Classification E-value
Superfamily YWTD domain 1.2e-36
Family YWTD domain 0.0000378
Further Details:      
 
Domain Number 3 Region: 401-492,733-783
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 349-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000574
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 981-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000331
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 6 Region: 913-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000644
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 319-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000194
Family EGF-type module 0.032
Further Details:      
 
Domain Number 8 Region: 834-874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000397
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001408   Gene: ENSONIG00000001112   Transcript: ENSONIT00000001407
Sequence length 1065
Comment pep:novel scaffold:Orenil1.0:GL831156.1:1796934:1817668:-1 gene:ENSONIG00000001112 transcript:ENSONIT00000001407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HVIVYIVILPNPFSYCIVLFIAELTILFSYSCIFFVFTDNGILVCYSSQPFLIFGHGKAI
HRMGLNGKNHRRLVPGVGSSILLDFHFKEQRVYWVDRHTGVIYKASVKGAHKQKLYSYDK
HISGLAVDWIWNSVYWTSGEKGEVKRIDINGRKQRTLLRHLTQPNSITVDPSNRFLFWLS
AGMSPSIQRSDVTGQMKITLIKITEQLRALSIDRVDKRLFWVQFGPQGESAIASCDYNGN
ALHIMNLPLQSHSVGISVFLEHIYYTDAESRVIKQVNKYTGGEPRVVNLKQMAKPPVDIK
IVHPLNQPTADPLSPFPGCDDQGGNCVNVCSSLADQGVCQCSEGFVLSMEGTYCKDVNEC
AHWNHGCSLGCENIPGSYFCTCPKGYALLPDRKTCQEIIPCERNMTKCGNGCLSTGNGAV
CVCPEGSILQEDGQTCTGCSSADRGGCSQLCNPVTPVSWECGCLPGYQLHQDGKHCIATG
PPSYLLVANLVDVRRINPDGTVDQILAEEPRGIILALDYDPVQNNVYFASASQKTIERVD
IKGGPRNILISDGLDSPEGLAVDWVHRKMYWTDKSQSTVDCSTLDGLHRETIVRKGLEKP
RGIAVHPLAKKLFWTDIGTHPVVECSSLEGRDRAVIARTNLVSPTGLTIDFTEDRVFWCD
QRKGTIETAALDGSDRRVLSENQVGQPFDLALFEDRLWISDQERHQLTSVHKRTGKNLQR
IQGSMVQPASIVVVHPLAKPGADMCLHLNGGCSQVCESKVGFAHCSCFSHYILSADGKTC
LSVDASNGTAEYGNSGSVDLTPLKNKTFNTASLPLTTDKDVSSQPTFFTEKMISDQNECY
SLRCDVNAQCLLNSGHPNCLCQEGFTGDGQLCVGEYTFNYTRIIPPIVSLQTRLSAEFVC
KCTRPELAAPIFVLDIDECTLGTYNCDKNEECQNTAGKYYCKCLAGYYSDGQSCQELEPT
SPWVTPATSPDVTTKHHSRNAVESCPATHETYCLYHGVCYYFPELDSYACNCVSGYMGER
CQFSDLEWLELQRAEKEKKRNVVITACMVVLVSVLSITACVTYCY
Download sequence
Identical sequences I3IXR8
ENSONIP00000001408 ENSONIP00000001408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]