SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001686 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001686
Domain Number 1 Region: 259-530
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-84
Family Protein kinases, catalytic subunit 0.000000000493
Further Details:      
 
Domain Number 2 Region: 145-292
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-40
Family SH2 domain 0.00000276
Further Details:      
 
Domain Number 3 Region: 81-196
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-27
Family SH3-domain 0.0000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001686   Gene: ENSONIG00000001335   Transcript: ENSONIT00000001685
Sequence length 538
Comment pep:novel scaffold:Orenil1.0:GL831153.1:4590429:4599386:-1 gene:ENSONIG00000001335 transcript:ENSONIT00000001685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMGCVQCKDKEAAKLTDDRETSLSHNSGYRYGSDPTPQHYPSFGVTTIPNYNNFHSAASQ
GVTVFGGVHTSSQSGTLRSRGGTGVTLFVALYDYEARTEDDLSFRKGERFQILNSTEGDW
WEARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSNGNARGTFLIRESE
TTKGAYSLSIQDWDDVKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSARAAGLC
CRLIVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGTTKVAVK
TLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEG
RGLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIEDNE
YTARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQV
ERGYRMPCPQDCPSSLHELMLQCWKKDPEERPTFEYLQAFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences I3IYJ6
ENSONIP00000001686 ENSONIP00000001686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]