SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002130 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002130
Domain Number 1 Region: 1176-1403
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.89e-39
Family Laminin G-like module 0.00094
Further Details:      
 
Domain Number 2 Region: 225-337
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-31
Family Cadherin 0.00073
Further Details:      
 
Domain Number 3 Region: 330-434
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-29
Family Cadherin 0.00073
Further Details:      
 
Domain Number 4 Region: 641-753
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-27
Family Cadherin 0.00084
Further Details:      
 
Domain Number 5 Region: 115-223
Classification Level Classification E-value
Superfamily Cadherin-like 7.98e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 538-640
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-26
Family Cadherin 0.0017
Further Details:      
 
Domain Number 7 Region: 10-113
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-26
Family Cadherin 0.0022
Further Details:      
 
Domain Number 8 Region: 746-847
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 1420-1622
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-23
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 10 Region: 435-536
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-22
Family Cadherin 0.0019
Further Details:      
 
Domain Number 11 Region: 1115-1155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000718
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 849-951
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000514
Family Cadherin 0.01
Further Details:      
 
Domain Number 13 Region: 2211-2476
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000915
Family Rhodopsin-like 0.036
Further Details:      
 
Domain Number 14 Region: 1702-1798
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000146
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 15 Region: 1624-1658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000617
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000002130
Domain Number - Region: 1659-1706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000203
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1096-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00727
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 1792-1855
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0207
Family Hormone receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002130   Gene: ENSONIG00000001701   Transcript: ENSONIT00000002130
Sequence length 2986
Comment pep:novel scaffold:Orenil1.0:GL831166.1:387455:501904:1 gene:ENSONIG00000001701 transcript:ENSONIT00000002130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSKRAANRHPHFSQYTYQVHVAENQPPGTSVIIMSASDPDGGDAGRLSYTMAPLMNSRS
SDYFHIHPDTGLITSTQILDREHMDLHYFRVTATDHGSPRLSGTTMVSITVSDRNDHSPI
FEQSEYRETIRENVEEGYPILQLRATDSDSPSNANIRYRFVGDSATMARAAFEIDPRSGL
ITTRGSVDRETNEHYTLQVEASDQGKDPGPRSATVKVFITVLDENDNVPQFSEKRYVVAV
KENVRPHSEILRVSATDRDKDSNAVVHYNIISGNSRGQFSIDSVTGEIQVVAPLDYEAER
EYTLRVRAQDNGRPPLSNNTGIVSVQVTDVNDNPPIFVSTPFQASVLESAPIGSSILHIQ
AIDTDSGDNARLEYRLTGTSSDTPFVINAATGWVTVKSILDRESVEHYFFGVEARDYGMP
PLSATASVTITVMDVNDNRPEFLQKEYYVRLNEDAAVGTSVVTVTAVDRDVNSAVTYQIT
GGNTRNRFAISTAGGGGLLSLALPLDYKQERRYVLTVTASDRTLHDTCQVHINITDANTH
RPVFQSAHYSVSVNEDQPPGSTIVVISATDDDVGENARITYFLEDNIPQFRIDPATGAIT
LQAELDYEDQMTYTLAITAKDNGIPQKSDTTYVEVNVNDVNDNAPQFLSPRYQGTVSEDA
PSYTSILQISATDRDAHANGRVQYTFQNGEDGGGDFTIEPKSGIVRNSRRLDRENVPFYE
LTAYAVDRGVPSQQTPVHIQVTVLDVNDNAPVFPADDFEVLVKENSAVGSVVAQITATDP
DEGANAQIMYQIVEGNIPEIFQMDIFSGELTSLIDLDYETRNEYVIVVQATSAPLVSRAT
VRIRLVDQNDNRPTLQDFQIIFNNFVSNRSNSFPTGVIGRVPAHDPDVSDRLYYTIDRGN
ELHLLLLNHTSGEIRLSRKLDNNRPLVAPMLISVTDGVHSISAQCVLRVLIITEDMLGSS
VTVRLQNMSQEHFLSPLLGTFLEGVSAVLSVPVEDVFIFNIQPDLDAAPGGILNVSFSAA
LPGGHFFPSEALEEQLYLNRPRLTSLTQMEVLPFDDNVCLREPCQNYMKCISVLRFNSSA
PFISSPSILFRPIHPIAGLRCRCPVGFTGDYCETEINLCYSNPCLNGGVCARREGGYTCI
CREDYTGDRCEFDHRQGRCMPGVCRNGGTCQELSGGGFRCECPAGGYERPYCTVTARSFP
PKSFVMFRGLRQRFHLSISLTFATLENSGLLFYNGRFNEKHDFIALEIQEGQVVFKYSTG
ESSTQVSPFLPGGVSDGNWHTVHIHYYNKPKRSMSGEAQGPSDEKIAVVSVDDCDTALSL
RFGTQLGNYSCAAQGKQTSSKKSLDLTGPLFLGGVPNVPDNFPFGTREFIGCMKELHIDS
KPLDMAGFIANNGTLPGCSAKHPFCKSNPCQNGGTCRVSWETFSCDCPLGYGGKDCSHVM
THVHRFLGNSALWWDLKNDVTISAPWYLGLVFRTRAREGTLLQAQAGQYISLVFQVINGQ
LVFSVTRGSTRPVRLRLDQVQVADGRWHDLQLELRDVRSGRETRYVATLRLDFGLYQGTV
IVGNEIHGLKVKHLHVGGVLGSGEVQNGIRGCIQGVRLGVRPDAPALPRPSRAVKVETGC
SVGNPCLSSPCPAHSRCSDQWERHTCLCEPGYYGKSCTDACHLNPCENEAHCHRKPSSSH
GYICDCGDNHYGQYCQHRIDHQCPRGWWGSPTCGPCHCDTNKGFDPDCNKTSGQCQCKEF
HFRPRNSDTCLPCDCYPVGSFSRACDPESGQCQCRPGVIGRQCNSCDNPFAEVTNSGCEV
IYDGCPKTITQGIWWPRTKFNLPAAVPCPKGSVGAAIRHCDVERGWLEPDLYNCTSPPFV
ELSAALDSLERNETELNTIMEKKLAHQLRDVTEATTRLYGNDLQIAERLLSRLLTFETQQ
SGFGLTATQDAYFNENILRGCSVLLGPSTSGLWRALAQSQNHIPGGGPGALTELLEQYAK
NLAQNMKLTYLNPVALVAPNIVMNLDRVENHTHVRRRFPRYHTTLFRSQALWDPYTHVIL
PLSASDPQNTASAPVSISANQTGEYTAAKRTAALPEPPITIVILLIYRSLGAALPPKYHT
DRRGVRLPRHPVMNSPVVTISVYNNQTFVGGHLEQPILLEFKLLETANRSKPLCVQWNHS
SPYEMGGCWTVRDCMVVYRNTSHVRCQCQRLGTFGVLMDSSQREQLEGDLEMLALVTYSS
LCVSMLALLLTVLVLSCLRGLKSNTRSIHSNTAAAMFLSELVFLLGVNQTEQQFLCTVVA
ILLHYFFMSTFAWMFVEGLHIYRMQTEQRNINYGAMRFYYAIGWGVPAIITGLAVGLDPE
GYGNPDFCWISIYDKLIWSFAGPIGIVILLNGGIFTIVAKMSCNPSQKEAKKLPVIATIR
NAFLLLLVATSTWLCGLMAVNNSILAFYYIFDVLCLVQGLSVMLVFTVFNSEVQEAWRVA
CLGKKSPGEDPPRPPQSTAQNPYHNASLLEQSGLHRITLGTSTISSVSSARYLNACTHEW
THVTVFTNILRENLLARQTLEQNIVHTGATDLDVAMFHRDGGEDSDSDSDLSMEEERSLS
IPSSESEDNVRLRGRIQRRFKRSNHGERLLTEPANNGTKELDGNDLLSYWPALEECEARS
LQKWGSERPLGADYSKDAANNNQLDAALTSGDENGLTQPHRHRKGILKNRLGCPPALQGL
SSMGRVPSELNWYRTSTLGHRGVPAASYGRMYSATAGATGGSGSLSQPASRYSSREHLDS
LARRQLSRDPLGRQTVGGSRDRLDCRGSRDNLDLLPRRRELGLGQGSISLTRRQASSREH
LGEALVSSRSREQLDTNGMGAQAQPCREWLRTLPPRQPSHPDQPPSSSPPPPISEEPQQE
HLPPSAHARGRLDSASCRFPGQAAPQVAGSNPNPLGRQPSSEHLDILSSILASFNSSVLT
PPPTAPNPGPNGSVHGPSPSPSQSATSHSISEVSPDSEANRSEGQS
Download sequence
Identical sequences I3IZU0
ENSONIP00000002130 ENSONIP00000002130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]