SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002637 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002637
Domain Number 1 Region: 432-567
Classification Level Classification E-value
Superfamily TIMP-like 9.26e-33
Family Netrin-like domain (NTR/C345C module) 0.023
Further Details:      
 
Domain Number 2 Region: 211-305
Classification Level Classification E-value
Superfamily Immunoglobulin 5.33e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 384-439
Classification Level Classification E-value
Superfamily BPTI-like 5.68e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 
Domain Number 4 Region: 322-381
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000156
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.018
Further Details:      
 
Domain Number 5 Region: 124-172
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000115
Family Ovomucoid domain III-like 0.025
Further Details:      
 
Domain Number 6 Region: 37-89
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000419
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002637   Gene: ENSONIG00000002115   Transcript: ENSONIT00000002638
Sequence length 576
Comment pep:novel scaffold:Orenil1.0:GL831257.1:653942:657753:1 gene:ENSONIG00000002115 transcript:ENSONIT00000002638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWMLFHRWIWFLLGHCYTLLLYIDSCRVRAMPMSVAKVVYSHAGLCPNDLNPNLWVDAM
STCMRECESDQDCETFEKCCPNVCGNKSCVAARYIDIKGNKGPIGMPKGATCDKFMCSQQ
GSECDIWDGQPVCKCRDRCEREPHFTCASDGMTYYNKCYMDAEACSKGISISEVTCRYHL
TWPNTSPLPVETTLHPTTALQTTLPTDIQLPAIHNGPSQQAVFVGETATFLCEVSGKPHP
EITWEKQLKGKENIVMRPNHVRGNVVVTNIGQLVIYNTQLQDAGIYTCTARNVGGSVSSH
YPLVVIKKETKGKNPEGNSTNLPFPAAECLKSPDTDDCGEESISWYYEPKRNNCFTFTYS
QCNKNRNHFDTYEACMLSCGGELAAPCSLPSLQGPCKAYEPRWAYSSTLKKCQSFVYGGC
GGNENNFQSKEACEEMCPFPKNNNCKVCKPRGKMVASFCKSDFVILGRVTELTEEQESGH
ALVTVEEILKDEKMGLRFFGKEPLEVTLLNMDWNCPCPNITVADGQLIIMGDVHNGMAVL
QPDSFVGSSSNRRIRKLREIISKKTCDFIKDFSTVQ
Download sequence
Identical sequences I3J197
XP_003452889.2.78416 ENSONIP00000002637 ENSONIP00000002637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]