SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002671 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002671
Domain Number 1 Region: 179-447
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-83
Family Nuclear receptor ligand-binding domain 0.00000000295
Further Details:      
 
Domain Number 2 Region: 126-207
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.76e-31
Family Nuclear receptor 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002671   Gene: ENSONIG00000002143   Transcript: ENSONIT00000002672
Sequence length 453
Comment pep:novel scaffold:Orenil1.0:GL831140.1:2786162:2811001:1 gene:ENSONIG00000002143 transcript:ENSONIT00000002672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSNDPYLHLNSTGPMSTAHAHPPSMGSMVGHPSVISTSRPLPSPMSTLGSPMNGLASPY
PVITSSLGSPSVSLQSTPNMNFGPLSSPQMNSMNSVSSSEDIKPPPGLQNLGNINYQCTS
PGGMSKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLSYTCRDNKECPIDKRQRNR
CQYCRYQKCLAMGMKREAVQEERQRGKERGENEVESTSSFNEDMPVDKILDAELAVEPKT
ETYSDGSPGNSTNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELL
IASFSHRSVTVKDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMDKTELGC
LRAIVLFNPDAKGLSNPSEVEGLREKVYASLESYTKQKYPDQPGRFAKLLLRLPALRSIG
LKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQIT
Download sequence
Identical sequences I3J1D1
ENSONIP00000002671 ENSONIP00000002671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]