SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003598 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003598
Domain Number 1 Region: 151-417
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.6e-78
Family Nuclear receptor ligand-binding domain 0.0000000112
Further Details:      
 
Domain Number 2 Region: 99-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.38e-31
Family Nuclear receptor 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003598   Gene: ENSONIG00000002873   Transcript: ENSONIT00000003599
Sequence length 423
Comment pep:novel scaffold:Orenil1.0:GL831286.1:681433:687408:1 gene:ENSONIG00000002873 transcript:ENSONIT00000003599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFFFSAGSLQAMSSQQPNSSASNSPTSILGSPFSVISPSLNSPVVPHSLGFGPISNSQIS
SSAPISGMHSVSSSEDIKPPFGLRPMQAHSPGIMLSQKRLCVICGDRSSGKHYGVYSCEG
CKGFFKRTVRKDLSYTCRDNKECLVDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRNRE
REGELEFSVGVNDEMPVEKILEAETAVEQKTELHSDGGSAGNSPHDAVSNICQTADKQLF
ALVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIPLKDGVLLASELQRDSAHS
AGVGAIFDRVLTELVNKMRDMQMDKIELGCLRAIVLFNPDAKGLSNTGEVELLREKVYAS
LEAYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPH
QLS
Download sequence
Identical sequences I3J408
ENSONIP00000003598 ENSONIP00000003598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]