SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004965 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004965
Domain Number 1 Region: 800-942
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-41
Family Toll/Interleukin receptor TIR domain 0.0000204
Further Details:      
 
Domain Number 2 Region: 365-737
Classification Level Classification E-value
Superfamily L domain-like 1.6e-40
Family Ngr ectodomain-like 0.032
Further Details:      
 
Domain Number 3 Region: 52-354
Classification Level Classification E-value
Superfamily L domain-like 6.32e-36
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004965   Gene: ENSONIG00000003939   Transcript: ENSONIT00000004968
Sequence length 959
Comment pep:novel scaffold:Orenil1.0:GL831369.1:739742:744210:1 gene:ENSONIG00000003939 transcript:ENSONIT00000004968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIQRHMRAHGSCFQQLYLGSCFMLEFPRLKENNPSLPYALKNCSVQFSVDVRDVSVTCS
DRDLAAVPDDIPRNASTVDLTNNHIQMINRRDLGGLSKLVYLQIVLNSLSHIDDGAFADM
GELRELGVSRNSLRNLTANIFQGLSKLVKLDLTINQITYISPLAFQNLISLQKVGLNSNN
LHQMSEIVPILLLPNLYELDAGMNMFSSFDSDSLHVNKSNLRRLLFNGNPLKEFSIRRDI
FPDLQYMDLTKCSDGFVPDVPDKTFLRSLTVLLLSGTEIRFETYRTILQSAESVTYLWLS
YVKEWFDKGLIDIACQIPALTNLDLTFNDILVLNDTLLRMCSNITELALASNQMDLNTGL
SQISLRGLNQLEQLRIEFNFLASVPAIRGLSTLLVLSLTSNDIGELGCSDFLKLTRLMQL
FLSNNRISKLRGCVFRDLNNLRLLDIEGNLIFSLSDTFTGGLQNLRILLMRGNDLKQLEK
GYFESVPMLLSLDLASLSSYYVENGTFEELHRLESLIITAFTLTKDMFRGLRNLKSLTIY
FPASLNNMTNQLFDGPAFLNLPSLRELTIKHNNRYTLVISPDVLRGLRYLQRLETEKFFT
TMPHPDTFTFTPLLTSLKLISSNVSLPTPELFGPIPNLQALDLSKNKLWSLDFLISVNLS
ALSWLKLRENELTVINETVFQYLSALRYLDLFENPFTCNCSNIGFIQWVKHNNQVQVVNA
YQYECFCPPSKQGTKLLDFDIQSCWMDISFICFISSTCIIVLTLLTSFIYHFMWQLVYAL
HLFLAFLYDNRKRKKGILCQYDAFVSYNVRDEEWVCREMLPVLEGEQGWRLCLHHRDFQP
GKPIIENITDAIYSSRKTIGVISRSYLQSEWCSREIQMASFRLFDEKKDVLILLFLEEIP
AQQLSPYYRMRKLVKKRTYLSWPRAGQHPGVFWQNVRRALETGNAPNETTNLLTCSLPP
Download sequence
Identical sequences I3J7X5
ENSONIP00000004965 ENSONIP00000004965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]