SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006282 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006282
Domain Number 1 Region: 159-252
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-23
Family I set domains 0.0089
Further Details:      
 
Domain Number 2 Region: 262-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000037
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006282   Gene: ENSONIG00000004994   Transcript: ENSONIT00000006286
Sequence length 732
Comment pep:novel scaffold:Orenil1.0:GL831183.1:2325376:2403823:-1 gene:ENSONIG00000004994 transcript:ENSONIT00000006286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQPREPCRNATSDHRAKAGGMRLDSVHLSMLVIGVSFACYSPSLNSLQDQAYKSAVVIEG
KVQSTPVNVSAEPYRVNVKVLDVWPLNSGGLEREQLVTVGEFGSEAPCTKVKKNHKYIFF
MDPTDEPLVFKASFAPLDTSGKNLKKDVGRILCEDCAAAPKLKPMRNPMIVDEGSKLTVR
CEATGSPAPTYRWFKDGNELKESKKVRIKNGKKNSRVQISRAKLEDSGNYTCVVENPLGK
DNSTGTVNVQSMTTTPSPGSGHARKCNDTERAYCVNGGDCYFFHGINQLSCKCPDGYFGP
RCLQTEPLRVYMPNPFKKSRKLKAQELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQR
NRMHNHLRQNMCPEHPNRNLANGPNHPGPGPEDIPMVDYISKNVPATERVIRPATEGSFP
ASHASSRSHNSSTRAHSSTHRHEERTWSLEHSDSILSDSPGMMSSSVGTSKCSSPACMEA
RARRAAHCGYSDPHRPRLQYGDSFDSLGDSPHSDRYVSALTTPARLSPVDFHYSLPPQVP
TFQITSPNASHAMSLPPAVHNPYPLEDDQPLLRRYQVPLHDAHCQEPYRQQRRTYLNDSR
GSLPSSPYRLAEDEDYETTQEYLSSREQPKRSGSSGTGSRRWRRSRLNGHVAPRGYEASR
DYGSRSCLTDSESEEDGESTPFLSMQNMNAEPSTIYRPADSRTSNSSGRHSGHGNTHTRL
TQSRSKPDNTPH
Download sequence
Identical sequences I3JBP2
ENSONIP00000006282 ENSONIP00000006282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]