SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006627 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006627
Domain Number 1 Region: 4013-4065
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000457
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 2 Region: 2448-2709
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000313
Family Extended AAA-ATPase domain 0.09
Further Details:      
 
Domain Number 3 Region: 2797-3037
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000623
Family Extended AAA-ATPase domain 0.035
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000006627
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.0275
Family NOB1 zinc finger-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006627   Gene: ENSONIG00000005273   Transcript: ENSONIT00000006632
Sequence length 5221
Comment pep:novel scaffold:Orenil1.0:GL831217.1:1576573:1610051:-1 gene:ENSONIG00000005273 transcript:ENSONIT00000006632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCSGCAHNIVEKEAKFCSKCGKKLSVQPANAQDAGDQPKSLVADGEGPTEKPDSQKNTP
PVDSKESSKSPKRPNDEVINNNPKKKKKKKRRNKKKKDGAVSSDQDLSHISLGDKQGKET
QGERDSSDSESSDNAMDTTPDSLQDRLSSCESQPSSLTANDIVATAEDAQVNQSEKSDGP
VQANTVERSEVATSRPNEMESSAQESPDNQSQKTGPADTPAERPASEDKKSTTSQSASSE
STKATTAKDPKEKTLKNQKEADNAKKPKQDQNANVAANAKQSKENTQKGKNQKEHKPKQA
VANDQQMVFGPHTAKAHNTGSSVDPVENMEIQQSGTGQDSTPAQASNDNKGSKDGSGDSK
NSKTQTALPPRRPTRNTTIAARDRLTIYFHAILSKDFKFDPSEDRIFIRAGSCIGNWDED
IVELSVSRALGEHGFLVEGSLTTSKKEAVSESIPYKYLVYKNKKQEYEFEYIYKLDSSHH
TTNRCLFVKPNLINEDGDWHQYDDIICAEPSKNMLKRIYALWSDQRTKLIQGREIAGNIM
LETIFDLLSSWSATNLRSFLLQLNQFMQVYGEPFVYEEKEKKWSSLNYGKEDVKMMVKGF
MLSYVIPQLLKDGNRKSLYIEDPLRAAVITLHVWTQHHIKLENSELHQLCTALCLPKLEK
DTFLQYWVEFSQDVSILSLPETLVSLINTVKRKGMTRWIMVLPLLHLIKGSTTPFQAPAS
GNMKYGPSWAGLQGLDIGTTAYTSNMSSQDKRSLINVMKSCSHLMEVDALSLRSCLYLMS
LSELTECSTELKAELLDMLHAFFIKAPQEVTAGNMQAVSDILSHIQGNLIEEKYSYFTEA
YRKECLATSVKLLEKLCNGVKPASHTQNYPDIPVACMNLVASVSNFVQCNKPQETQERDE
EQRYVKTMVMTQAVKIMRGWIAQSFNQSFLNNSWFSRQEKTKEEIEMWNNIISIHFKDED
CTTEWRQIFTMDFEGKYKRESALDQIEYYCTNMEDLSCSHPHVAASIERCALEAVTSLCQ
NKNEGKLLERLKINWKFGKLISAIIQKSWPKNHQGEYHQDEEVVLQHLLSWTAAKNIFQL
HGADEKLIEKLSQDAKDRIAIAISSFTSVKNQLVHGNIKINLLKIILGRRDAFLELLKID
CLAENGQYKDHDKMKRLLKYREDEVEAVYHEKELVDVLLTKSHQLEEHMTVDVAELEGNQ
QVNIMTTPLDHFMEVHQFDQMPSPITGIVTYFNLDEEIRNMAEELYTFSDSIVFKMCWDK
QAKFLATEEMEDNPDEHQVADIRATLQMIHDDIFIDCYNHYEDIYTRLKDGTIRLEEVNQ
FFKAFKGKYEDLAKDLEIMCRMKNSRDKQWINSRVQQIEQYHELHLAVTSAQVIMKVKET
LGLQGDFRVLETLTEVNHIDFQKEPLSRIDNELMQAKTVLVDITEPRRLCLQELELRGHF
VKWVKDALEDINELKVFVDLASISAGENDMDVDRVACFHDAVLGYSSVLYELKPDSGFKA
FNEVLTKLWRALENDSNLPKKLRDSARHLEWLKTVKDSHGSVELSSLSLASTINNKGIYL
ISAQNVKKLSLDTALKLQIPEEHDDGQQMRCYSLEDLRELQNKLMLMSGKGDQGQCEVDY
FAEVFASVQRLAEAFIALYTAGNPLFRHWEVQINCCSKSQAPSIMMDFNLDSVISVIVEG
SIEEKLPELCKKMEKCLDFWMVFVDKQRSQHYYLNYYTAEQIVYLCNKLTLQNVTNVEDQ
VLMMLSFIKPNCTYSDLREVWHELQYEILKKPEEQNEDIEFQTFVVVQSSEGEDPDFISQ
LGPLASLVEQAKGLPKFDHIWNAYMKDMRNFLPNILDIKNLGRLLGILANKHNESQEEDI
SDDDTGNFINRHVPRGLAVGNPNLIVCPHDEVLSSCISIYMSSENETLPTYDEVLLCNST
TPYEQVELFLRRCLSTGYRGQKIYCLLYGDLLPYDVSSKAENFFQRLKMQSRKDYRLVII
CSSEREHTYLPSAFSQYRLHMVPQEPLARIQSYLQKHYAVPADECSAAAAFKDRLCVGVI
SATRAGVGKSLYIRRLYEKLKRSTKKSSVMKCIRLIEPNVDENVILQSLLDAPRRKELTV
FHFDVTSSVQKGLHEFLFKLLILRYLLDSEGKMWKCNNKQLYLVEILEPTVKSGRNVSLQ
TQKIKSSFIDVFPNIFCRPPKEVLMLEMRKQEDPTIVSNDDPLMDDEEFRSEAFQRPYQY
LTRFHNHINLDVFTYNGVEGTHVECLQMLLMFCGIMDPSWAELRNFAWFLNLQLKDCETS
VFCDVTFTGDTLTGFKTFVVDFMILMAKDFASPSLSISDQSPGRLEIDLAGVRDEDLAPF
LIRKRWETEPHPYIFFNDDHVSMTFIGFHLQLNEQNFVDAIDPTSNRVIKRNVMTRALYE
GLRLQRVPFNIDFDRLPRAEKIERICSVLGIQWPLDPDETYELTTDNILKMLAIHMRFRC
GIPVIIMGETGCGKTRLIKFLCELRRSGVATENMKLVKVHGGTTSEMIYTKVREAEDIAS
INKLDYGFDSVLFFDEANTTEAISSIKEVLCDKTVKGESLTANTGLQIIAACNPYRKHTD
EMIQRLESAGLGYRVRAEETDEKLGSIPLRQLVYRVQALPPSMIPLVWDFGQLNDHTEKI
YIQQIVQRVAEKKAIDECYIKWITDVLSSSQKYMRARNDECSFVSLRDVERCMQAFVWFY
DNHEMFFAELKKFENDRNVEKDEMRPKWPENRDPVLWSLVMAIGVCYHACLENKDKYRQK
ISKSLPALYSPSKVKQEISLMQDLLLSGVPMGDTIARNSALKENVFMMVLCIELRIPLFL
VGKPGSSKSLSKTLVADAMQGQAAHSDLYKKLKQIHLVSFQCSPHSTPEGIINTFKQCGR
FQEGKNLDEYISVVVLDEIGLAEDSPKMPLKTLHPLLEEGCIDDEPLPHKKVGFIGISNW
ALDPAKMNRGIFVSRGDPDLKELTESAKGICSSDAVVLEKVRDFFQPFARAYLKICLKQG
KGFFGLRDYYSLIKMIFAVAKASKRKPTPEETVKAVLRNFSGKDNVDPVTVFTKRLGIAP
NLENISTIEFVRENIEAVGQEEECRYLLVLTKNYAALQILQQSFFSESGQPEIIFGSSFP
KDQEYTQICRNINRVKICMETGQTVVLLNLQNLYESLYDALNQYYVCLGGQKYVDLGLGT
HRVKCRVHKDFRLIVIEEKEVVYKQFPIPLINRLEKHYLDIQTVLKTEQKRMVEELEKWV
QLFVTLSSQHAAAAQTYKYKPPDVFIGYHSDTCASVVLQVIENQKDSLEISDSERRMLDE
AKLVLLKCATPDSVVRLDCTALPKVESEYLARMYFEEQNNSCLADYILAHTRQETHSCSF
FTEVTTFSRLLTAFDLEPLERMLHSVELLSLQQFDTEHSFLKKIRNFLTAENKSSSNRVL
IIQSDFDEASLSANLIASAKYSSINEINKITQENTGRKVFVYFITRLPRMEGGTSYIGFH
GGPWRSVHIDDLRRSKDIVSDIKTLQNMTISQMFETKAPQAEAMETDDMYTESEQEETEQ
EENTWESVVDTTALLRSCVQSAVAMLRDQVESGLRSTRRVEILLTLLSDNDEITGEFLQV
VKRHLHSLLVTHDGNTFSSIKSNWVLKEASNIDALQEGGTFRHTLWKRVQAVVVPLLAHL
VSLIDRDQNMDLLLDTRCGESVKKLWLDIFGNEKLLEISHLTLDHTSETRTILVQHYIAQ
DKNMSCSMPFSWRIKDYLEELWVHAHQHEGQTQKEFVNFFWKTPLGRYIAKADPEMQVEF
FQRYLQDFISITMNVTSREDLQLLCGALNSCVNELRLQLSDTEAVASLPWVHAAYHEFKN
RLQNLCRVMCIVPQLTQNLLMNPNARGGDELVLDVYAGFACVEYLEPIDLNTDARRQAWL
RQVKKIQVAIELICSEDSVRHYGERSKIIAKRVQAGWNRIFSLSLFVEHMLLGIEELEKK
LSPLVLENTGRLGQILEKNSDLKTQETFEAVIRLLKTCKDGAIERIFRFGLTLCPVCMGD
PQDPLCLPCEHIYCVACIKKWLVPGQMYCPLCMQPVNDDFPLVPSNDIRIPIKQHAQFRN
KCNAFFIDLVSTVCFKDNSPPCSAVILHLLSFLMVEAGAVSILRGNKQIFTKALSPFDDS
VDKNPVVRSVVLKLLLKYSFDDVKKYLQQHLTAVERSNILEEMDKTELYTLYINCLEDSM
FERMQFRSTADQQACLQDESAFLTDFLQSRDQLSEKATVEYLQQVARVRMDLDMAVSMFV
EKLRAPGSREGGQNGSTAFLTSVTDLCRRSGNDWYRVYLIRKMCSQFGVEFVKKLLKSDQ
MSWIFPKEVQQKDEEVTPIDQYLVCGEDYKTIRNAVAKVVMEAKLDGLDEACERCKCLPQ
WKTVYLLLALYREVTTLYRETNASFHPKPEQVEALMSYIEKSKFLPSPQVKAFALSLVTN
QIGPLALRCGVSGAQCVSVDLAVHLAAVLLCGNQGILAPLKQLAMTPANMQAAFLPTMPE
DMLAVAQQAMGHLQWYHCPNGHPCTIGECGQPMQTSHCVDCGAVIGGNDHRPVPGFRIVQ
VQGDRTQTGHVLGDPGRRDNPDMLDTKSISPVPFTIIRMLTHMAMLLGSCSQPQSISAII
KPPVQDAGEFLLAHLRKDMKHLIRSLGKGTDDTISTVHLVINSLLETHQQQRWPVQYDNL
LSTKEARNGWEIEMSAAIITPHLKHLDRQLKEVNTFIRADSRISASPIMKLIYGDPQLFL
ASLPPKSLIHVSAVWSCREKVSLLSLTHIVEQNDGKDTLPVLWRFLHREAEIRLVKHLPE
ILALQRDLVKKFLNIAELTEGSIAEFLRNQKAVSLKTRYEKHIRIFLATWNQLRVSLATN
GEIKIPAEFCQNDLDLNSDFRVLLPRRHGPGLCSTALVSYLIALHNDIIYCVDKHTGEET
SYKVSPADLTDLHVIRYELERDVMPLVLSNTQYSIERGQETLHEYDLPKIEQQIISRFLL
GKPLITLNGLPTLVNRHDRNYEIIFKDIKEKVKQEPLQTLTLFAVAGELHSYSEVCDALS
MLEVALGFLAMTGGEPYMQLSSYLEEVLQMRNQMAQHILKAFGMCCLKHCVALWQLLASL
KSENMLRLKRDPFVGVSEKYKQALGEDEHRLLIGFFSKNSADTFLLEMHEFLVLFLKKPN
ATDTFRPDWGLKDTLVSQMERKDMDIPADVEELFPEEILLSHYVEAWKFIVTFKQERGQR
Q
Download sequence
Identical sequences I3JCN7
ENSONIP00000006627 ENSONIP00000006627 XP_005454976.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]