SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006901 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006901
Domain Number 1 Region: 173-419
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.06e-66
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 78-181
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000101
Family Hepsin, N-terminal domain 0.016
Further Details:      
 
Domain Number 3 Region: 45-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006901   Gene: ENSONIG00000005492   Transcript: ENSONIT00000006906
Sequence length 419
Comment pep:novel scaffold:Orenil1.0:GL831147.1:4718371:4727112:-1 gene:ENSONIG00000005492 transcript:ENSONIT00000006906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEISPSIPKHKDFKHRCIKFTVAAVISLLLLLLLAGVLLAYYFSSSCIHGIKCGDGNCVW
ESQWCDGVTDCPAGQDEANCVSLHGSSFLLQIYSTQSKAWRSVCSHGWTEEKGRASCQSI
GYSRGTYFKSGQQRADCNDGFLLVKSKFNPQASILQQLALQNTCPNNMVVTLHCTDCGSR
VNSSRASAGQLASLGSWPWQVSLQVAGSHRCGGAIISPYWIVTAAQCVTWATSPGDWAVY
AGIVDPLGPLFNPAYSVHRIITHEAYNSQTLKNDIALMRLSQPLDITGSRNIGPVCLPNV
GLKVTAHQKCWITRFGHRANDSGLPYLMEAQVSLIDAPECNSFIAYTNRISQDMICARDM
QAGGGVCHADGGGPLVSLMDGVWWLIGDSIWGEHCAGQDAPGVYGNVAYFLDWIHRQMK
Download sequence
Identical sequences I3JDG1
ENSONIP00000006901 ENSONIP00000006901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]