SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007589 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007589
Domain Number 1 Region: 346-607
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.39e-61
Family Nuclear receptor ligand-binding domain 0.0000000631
Further Details:      
 
Domain Number 2 Region: 274-351
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.78e-28
Family Nuclear receptor 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007589   Gene: ENSONIG00000006026   Transcript: ENSONIT00000007594
Sequence length 611
Comment pep:novel scaffold:Orenil1.0:GL831229.1:571584:593310:1 gene:ENSONIG00000006026 transcript:ENSONIT00000007594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKRTQLLEQLQFVQLKCTPRDMPCVQAQYGPAPPGSAYSGQSFSYQSESYSSDLMTPDY
TKLDLGGGEISAAATTSLPSFNVFVEGSYEPKSSCLYQMPTHRPTIKKEEESYPTAPPLE
AMSSSTMYFKQSPPSTPTTPSLPPQPGTSFLWGEEHPLAPSHPHSLASSLETGPLKSPRF
PHFYQHSPPHSGGSVGGYDSLGGGLVRTSSSSSSSSSSVSHPHGPPLEQPMYQLHRGAGS
SSLAFRSLALGPCGPLLADSLPSPPPRGPQGEGTCAVCGDNAACQHYGVRTCEGCKGFFK
RTVQKNAKYVCLASKNCPVDKRRRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSK
PKSPLQTEASPPSPPLSLLSALLRAYSHCTPRDLDYSQFSAADPPSSSSDVEHIHLFYRL
LTISMETTRCWAERLPGFSELQRDDQNLLIDSAFLELFVLRLAHRSMLSEDKLVFCNGLV
LHRFQCLRGFGEWLDSIQEFSAHLQNLNLDTSAFACLAALVLLTEQVPGLKDSKRVEELQ
NKVICCLRDHLGCSPSSSSSKAAPSLSRILGIREELRSQRTQGLQRIFYLKLEDLVAPPP
LIDRFLDTLPY
Download sequence
Identical sequences I3JFE8
ENSONIP00000007589 ENSONIP00000007589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]