SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007620 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007620
Domain Number 1 Region: 245-491
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.18e-87
Family Eukaryotic proteases 0.0000805
Further Details:      
 
Domain Number 2 Region: 156-251
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000615
Family Scavenger receptor cysteine-rich (SRCR) domain 0.022
Further Details:      
 
Domain Number 3 Region: 133-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000916
Family LDL receptor-like module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007620   Gene: ENSONIG00000006051   Transcript: ENSONIT00000007625
Sequence length 496
Comment pep:novel scaffold:Orenil1.0:GL831228.1:1272935:1286095:-1 gene:ENSONIG00000006051 transcript:ENSONIT00000007625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKHDPDTPPPPYYSVAVHTQPPLRSYEEVVYGLGPGVMPPSQPRYIPRYSPSVVAPQVS
QPSTIPKKKKGCCESKKRCIGVSLSVLLLLALLGLAIWLGVVYGTRSATSAIHYDEHDGS
DDMKTQSAVLPKDTCPNNTVICDGKEDCQHGTDEAYCVRFGEGNSLQVRTATDGRFLPVC
NQGWDNNEAMQICKQQGFRNAYMTGAIQSDSIGLTLNNSTRSAPIQARVNVSSPCPNKQT
VSLQCVDCGKQQATSRIIGGTVAKMGNWPWQLSLQFRGSHVCGGVLISPDFVLSAAHCFP
RDISAALSPQNWRVYGGTVSLNNLPAPYLVEKIIVNENYDTKTNDQDVVLLKLTSPVTFN
DKVQPACLPAYNQNFVQGTQCWTSGFGTTQASSGVASKDLMEVSVDIIDTQVCNSRDVYG
GLVTNYMLCAGKLNGGKDSCQGDSGGPLVCQGENRFYLVGITSWGAGCGEKNKPGVYTRV
SSVLPWIYTSMHRAMV
Download sequence
Identical sequences I3JFH9
XP_005455836.1.78416 ENSONIP00000007620 ENSONIP00000007620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]