SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008139 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008139
Domain Number 1 Region: 170-411
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.13e-71
Family Nuclear receptor ligand-binding domain 0.00000000153
Further Details:      
 
Domain Number 2 Region: 57-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.87e-28
Family Nuclear receptor 0.00000855
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008139   Gene: ENSONIG00000006456   Transcript: ENSONIT00000008144
Sequence length 416
Comment pep:novel scaffold:Orenil1.0:GL831179.1:3013744:3052316:1 gene:ENSONIG00000006456 transcript:ENSONIT00000008144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPMSNKQDSNSSEGDEKGWPDVPKRKRKNSQCSVKSMSALSVSVPGYIPSYLEKDEPCV
VCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGCCIIDKITRNQCQLCRFKK
CISVGMAMDLVLDDSKRVAKRRLIEENREKRKKEEMMRMLQTRPEPDTAEWELIRMVTEA
HRHTNAQGSSWKQKRKFLPDDIGQGPMVPTSDGDKVDLEAFSEFTKIMTPAITRVVDFAK
KLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAVKREQLKNGGLGV
VSDAIFDLGKSLAQFNLDDSEVALMQAVLLMSSDRSGLTSMEKIEQCQEAYLLAFEHYIN
YRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVECPNELFPPLFLEVFEDQEV
Download sequence
Identical sequences I3JGZ8
ENSONIP00000008139 ENSONIP00000008139 XP_005468631.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]