SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008188 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008188
Domain Number 1 Region: 153-433
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.42e-71
Family Nuclear receptor ligand-binding domain 0.00000000354
Further Details:      
 
Domain Number 2 Region: 99-178
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-26
Family Nuclear receptor 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008188   Gene: ENSONIG00000006493   Transcript: ENSONIT00000008193
Sequence length 464
Comment pep:novel scaffold:Orenil1.0:GL831220.1:14801:31155:1 gene:ENSONIG00000006493 transcript:ENSONIT00000008193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTTFPYGLHGDSGQIMFDYMEFQVFGPGEIVDFYSTSSPSCMLQEQDQDLAAFFPELIE
SDWQEHRYSQSVESQSSSSSFSSDDLFTRPASPPPPPRTYKPCFVCQDKSSGYHYGVSAC
EGCKGFFRRSVQKNMVYTCHRDRNCIINKITRNRCQYCRLQRCFAVGMSKESVRNDRNKR
KGKKEAVKMTIMETYELTAELGLIVEKICRAHRETFPSLCQLGKYTTNSSSDHRIQLDLG
LWDKFSELATKCIIKVVEFAKQVPGFTGLTIADQITLLKAACLDILILRICTRYTPDQDT
MTFSDGLTLTRTQIHNAGFGPLTDQVFTFAGQLLPLEMDDTESGLLSAICLVSGDREDLE
EPSKVEVLQEPLLEALKIYSRKRRPSMPLMFPKALMKITDLRSISAKGAERVVTLKMEIP
GSMPPLIEEMLEDLQNLEKHQKSVTTQHTHAVSSQHMNSAGFLL
Download sequence
Identical sequences I3JH45
ENSONIP00000008188 ENSONIP00000008188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]