SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010782 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010782
Domain Number 1 Region: 169-248
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000144
Family SH3-domain 0.001
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000262
Family IMD domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010782   Gene: ENSONIG00000008576   Transcript: ENSONIT00000010791
Sequence length 339
Comment pep:novel scaffold:Orenil1.0:GL831154.1:3705006:3718285:-1 gene:ENSONIG00000008576 transcript:ENSONIT00000010791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKNVRLDRDYLLGSRETYEVQLRSQAAALERLRRRPSQAYPQGGSEYVDFLRESHNQAL
QEEERRYRFLAEKHCGLIESFTKFMNKNGVTLQQQAAAWTEEVDATRRPEAHRPATLDNI
VGMREEEIRRSRDEMPLGKIPSRAPSPQGSVFRFGADSAGGGGGGGGGRVMKARVAHQPA
GSNPTLLTFNRGQIINVLVQQPRNGWLFGRADNSPRQGWFPASFVEAVDDPPVSPAPSRT
TLRSNSSMNSLPVSSQSGAAPPPPPPPPPLQSPSLNKPQSPSMNMAPPMNSNLSNSENKR
SQVNDSRPQLFPKGTNPFATVKLKPTSTNDRSAPRLYRR
Download sequence
Identical sequences I3JPI8
ENSONIP00000010782 ENSONIP00000010782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]