SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010804 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010804
Domain Number 1 Region: 120-375
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-68
Family Nuclear receptor ligand-binding domain 0.00000728
Further Details:      
 
Domain Number 2 Region: 51-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-30
Family Nuclear receptor 0.0000751
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010804   Gene: ENSONIG00000008594   Transcript: ENSONIT00000010813
Sequence length 404
Comment pep:novel scaffold:Orenil1.0:GL831154.1:4177852:4199995:-1 gene:ENSONIG00000008594 transcript:ENSONIT00000010813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVNQWPENISADPGSQLQICGQEPGGAPGTPNGSTPGNDALSGDKIPNVDCMVCGDK
SSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRGNRDCPIDQHHRNQCQYCRLKKCLKVGMR
REAVQRGRTSNSQSSPGQYLTNGTDPYNGQPYLSGFISLLLRAEPYPTSRYGAQCMQGNN
LMGIENICELAARLLFSAVEWAKNIPFFPDLQLMDQVALLRMSWSELFVLNAAQCSMPLH
VAPLLAAAGLHASPMSAERVVAFMDHIRVFQEQVEKLKALQVDTAEYSCLKSIVLFTSDA
MGLSDVAHVESIQEKSQCALEEYVRNQYPSQPNRFGRLLLRLPSLRIVSSPVIEQLFFVR
LVGKTPIETLLRDMLLSGSSYNWPYMPTVQRERPISLHYNENGP
Download sequence
Identical sequences I3JPL0
ENSONIP00000010804 ENSONIP00000010804 XP_003443189.1.78416 XP_004568636.1.88231 XP_005744124.1.53837 XP_005923742.1.24487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]