SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010998 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010998
Domain Number 1 Region: 31-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.9e-42
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 379-531
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000212
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 267-331
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000387
Family VWC domain 0.017
Further Details:      
 
Domain Number 4 Region: 688-760
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000001
Family VWC domain 0.0093
Further Details:      
 
Domain Number 5 Region: 555-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000675
Family EGF-type module 0.019
Further Details:      
 
Domain Number 6 Region: 520-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000469
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000010998
Domain Number - Region: 601-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 332-397
Classification Level Classification E-value
Superfamily FnI-like domain 0.000366
Family VWC domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010998   Gene: ENSONIG00000008749   Transcript: ENSONIT00000011007
Sequence length 813
Comment pep:novel scaffold:Orenil1.0:GL831160.1:3310862:3393606:-1 gene:ENSONIG00000008749 transcript:ENSONIT00000011007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLQLFLISGVFFVSSVIGFGVDPALRISVFDELTLGEGFDGVTQVQGFHSESRAFHFQ
GSSREVKAPVEVSEQMVHKLRGKNEFTVLVTLKQDHLNSGVILSIHHSEHRFLELESSGQ
RSEVRLHYRTKGQQDHTEVFPYSLADDQWHKVSVAVSASHVILHVDCNRIYERVVEPPYM
DIPEDTSFWLGQRNAAHGFFKGVMQDVEILVMPQGYISQCPDLNRTCPTCNDFHGLVQKI
MELQDILAKTSSKLSRAEEKMNGLDGCYCERTCSVKGVVYREDESWTDGCRNCTCTNGTV
QCEAISCPPPQCPAGTAPAYVKGACCKECQPVCLFGGRELVEGDQKAVRDSAGRCLLFEC
RDRTMHRVVPSEPCPELNCPESEQIALSGRCCKVCRGHDFCSEGNGCMENSDCVNLEAGD
CCVCKDGFRPLRDDNAYCEDIDECAEGKHYCRENTMCVNTPGSFMCICHTGYIRIDDYSC
TEHDECLSGLHNCDENALCFNMVGGHSCSCKPGYTGNGTVCKAMCDGLCQNGGTCVSPNN
CVCQQGFTGKRCETDIDECADGFVECDSKSTCVNLPGWYHCECRDGYHDNGLFSANGESC
VDINECKTGRNTCANDTVCFNLEGGYDCRCPHGHNCTGDCIHDNKVKHSGQIWVLDSDRC
SVCSCQAGQVMCRRMVCDCDNPNADLFCCPECDPRLSSQCLHQNGLLTYGSGDTWVENCQ
QCQCLQGQVDCWPLPCPPVDCEFTVVPEGECCPRCVTDPCQADTIRNDITKTCTDEHNIS
RFSGSSWIKHGTECTLCQCKNGHICCSVDPMCL
Download sequence
Identical sequences I3JQ54
ENSONIP00000010998 ENSONIP00000010998 XP_003444055.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]