SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011287 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011287
Domain Number 1 Region: 336-598
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-71
Family Nuclear receptor ligand-binding domain 0.000000000183
Further Details:      
 
Domain Number 2 Region: 263-341
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-27
Family Nuclear receptor 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011287   Gene: ENSONIG00000008976   Transcript: ENSONIT00000011296
Sequence length 600
Comment pep:novel scaffold:Orenil1.0:GL831187.1:2916925:2924220:1 gene:ENSONIG00000008976 transcript:ENSONIT00000011296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGSSPQGASPASQSYSYHTAGEYSCDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYNTSYDVKPPCLYQMPHSGEQSSIKVEDVQMHSYHQQSHLPPQSEEMMAHSGPM
YFKPSSPHAPSTPNFQVQPNHMWEDPGSLHSFHQNYVAATSHMIDQRKNPVSRLSLFSFK
QSPPGTPVSSCQMRFDGPLHVSMNHDNPGAHRGPDGQSFAVPSAIRKQAGLAFPHSLQLS
HGHQLMDSQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYV
CLANKNCPVDKRRRNRCQFCRFQKCLVVGMVREVVRTDNLKGRRGRLPSKPKSPQEPSPP
SPPVSLISALVRAHVDSNPSMSALDYSRFQANPDYQMTGDNTQHIQQFYDLLTGSMEIIR
GWAEKIPGFSDLPKQDQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRG
FGEWVDAIVEFSSNLQSMNIDISAFSCIAALAMVTERHGLKEPKRVEDLQNKIVNCLKDQ
VTFNGGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences I3JQZ3
ENSONIP00000011287 ENSONIP00000011287 XP_005453065.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]