SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013205 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013205
Domain Number 1 Region: 392-483
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.44e-39
Family Small-conductance potassium channel 0.00000323
Further Details:      
 
Domain Number 2 Region: 261-433
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.72e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013205   Gene: ENSONIG00000010506   Transcript: ENSONIT00000013215
Sequence length 582
Comment pep:novel scaffold:Orenil1.0:GL831134.1:10975723:11005240:1 gene:ENSONIG00000010506 transcript:ENSONIT00000013215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTEQKKLSHAGSKPSLSESCGRLPQIAMNTCKYNGGVVRPLVGSLASSSRRNLAELDS
ETQPLQTLHSSGLEVVVSKGNGGEDPSKASNESLVREGSGRGGGRAPQKKNRDIGYKLGH
RRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVYTKESSYSFALKCLISLSTVILLG
LIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQYVFTWTARLAF
TYTPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMK
TLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGD
MVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTA
ANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLA
KTQNVMYDLVSELQERSEELDKRIGTLEDKLDSVTGSLQALPCLISQAITQQQQDFLDGF
VHRFRPASLASERSERSERSWTSTARRRRSPSTAPHTSSDSG
Download sequence
Identical sequences I3JWG0
ENSONIP00000013205 ENSONIP00000013205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]