SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013214 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013214
Domain Number 1 Region: 119-390
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-67
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 51-131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.71e-30
Family Nuclear receptor 0.0000838
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013214   Gene: ENSONIG00000010512   Transcript: ENSONIT00000013224
Sequence length 405
Comment pep:novel scaffold:Orenil1.0:GL831134.1:11031907:11037178:-1 gene:ENSONIG00000010512 transcript:ENSONIT00000013224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVSGGWGDPNGGTNGLGDKGYLRGEEEDGSPQAGGSDMEAGEDDKACVVDCVVCGDKS
SGKHYGVFTCEGCKSFFKRSVRRNLSYTCRSNRECQIDQHHRNQCQYCRLKKCFRVGMRK
EAVQRGRIPPQPSLSPSITPIGGASGLGGGEFYNNNNGGSGGGQPVSELISQLLRAEPYP
NSRYGHQYNQQAGPDNAMGIDNICELAARLLFSTVEWARNIPYFPELPVSDQVALLRLSW
SELFILSAAQSALPLHMAPLLAAAGFHSSPMSAERVVSFMDQVRVFQDQVDKLTRLQVDS
AEYSCLKAIALFSPDACGLTDPVHVESLQEKAQVALTEYERMQYPSQPQRFGRLLLRLPA
LRAVPASLISQLFFMRLIGKTPIETLIRDMQLSGNSISWPYVPGQ
Download sequence
Identical sequences I3JWG9
ENSONIP00000013214 ENSONIP00000013214 XP_004542439.1.88231 XP_005721099.1.53837 XP_005920731.1.24487 XP_006786822.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]