SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013488 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013488
Domain Number 1 Region: 208-381
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.56e-27
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 2 Region: 423-622
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-21
Family Laminin G-like module 0.0091
Further Details:      
 
Domain Number 3 Region: 13-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000168
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 4 Region: 809-850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000201
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 5 Region: 692-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 6 Region: 653-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000187
Family EGF-type module 0.024
Further Details:      
 
Domain Number 7 Region: 404-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000007
Family EGF-type module 0.023
Further Details:      
 
Domain Number 8 Region: 725-765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000184
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 772-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000839
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000013488
Domain Number - Region: 181-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000384
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013488   Gene: ENSONIG00000010727   Transcript: ENSONIT00000013498
Sequence length 888
Comment pep:novel scaffold:Orenil1.0:GL831134.1:12419659:12426574:-1 gene:ENSONIG00000010727 transcript:ENSONIT00000013498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYIETLLLDQEAPLNVTFSFRTDQPVGTLLQRRVDDLLFSIELMHGHLCLLSLRGQGSST
LVQELPGYLSDSKWHTVEASLGGVVSLIRLLCTEGSCTRESNAEVQLLEQASSLPEPGAV
RHSLFIGATSGNWTLGRAVDEADYPPAFLGCFRDVFVDSRLLLPVIAPEGSRIQANITVG
CSDKDKCDDSPCQNRGRCVSQGWRGYLCECHRPYEGNNCAEEYITARFGNKDLESYAVFS
LDDDPGDTVIISMFIRTRQSSGLLLIMTNSTSQYLRLWLEAGMIKVQVNNFETLVGRAVI
NDGHFHLVTLKLEGVVATLFQSAQSQGSMPIRLIQVHPGDMVYVGGLPDSRASASFGGYF
KGCIQDLRINNKRLQFYQISTPVESYNLEQLISVAEGCSSDNACAVNPCLNGGVCYSMWD
DFICNCPPNTAGRRCEEVKWCELSPCPAAATCQPLSQGFECLSNVTFRLGSSIPQYRSNG
KIKRSLTSVSLSFRSRRLAATLLHAHKDSNYLTVSLLNSHVVMDLQVGGDKDNVSIQSQT
QFSDGKWHTVKLSLETQASTSSWIMIVDGGKEAISVSKTAVGDLEFLSKEVDIFLGGLSL
DAGVDLSGCLGPVEIGGLLLPFHPDTELNLPRPQEEQFLRINSNAPLLYGCWGASVCTPN
PCRNEGVCEDLFDLHQCTCSSEWTGHLCQDSTDPCISGPCLYGNCVSLPGGYKCVCEQGY
SGEQCEVEVDMCEKSNCSHGATCLKGFQTYSCLCPQNMTGQYCELPQLPVSTCTGTRWNY
SCFNGGNCAEAEDACYCLPGFTGQWCEKDVDECASDPCMNGGFCVNYVNSFECVCDMNYS
GIHCQIDVSDFYLYLFLGLWQNLFQLVSYLVIRLDDEPEIEWGFQIND
Download sequence
Identical sequences I3JX93
ENSONIP00000013488 ENSONIP00000013488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]