SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014279 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014279
Domain Number 1 Region: 231-505
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-80
Family Protein kinases, catalytic subunit 0.0000000369
Further Details:      
 
Domain Number 2 Region: 127-270
Classification Level Classification E-value
Superfamily SH2 domain 2.99e-38
Family SH2 domain 0.0000449
Further Details:      
 
Domain Number 3 Region: 47-135
Classification Level Classification E-value
Superfamily SH3-domain 1.08e-22
Family SH3-domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014279   Gene: ENSONIG00000011345   Transcript: ENSONIT00000014290
Sequence length 520
Comment pep:novel scaffold:Orenil1.0:GL831259.1:1048844:1059024:1 gene:ENSONIG00000011345 transcript:ENSONIT00000014290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIQKRFSTCWDSFLGCFKKKDPSEDETDRGEKSTVIKNLGAADKDEPSFHLNRNLPPLP
TTAVEYYVALYDYSARTEEDLSFNAGDTLEALDKSAGDWWFAKALTGVSASKQGYIPANY
VAPVESINAEPWYFPDTKRQDAEKMLMAGGNEHGAFLIRNCESQKGDLSLSVLDSGRVKH
YKLRKLDNGHYYVSRTKSFQTLKELVEHYSRQSDGLCARLGEPCKKIEVPQTYGLSYNTV
DQWEINRSSIKLLKKLGAGQFGEVFEGLWNETTSVAVKTLKPGTMDAEDFLREAQIMKRL
RHPKLIQLYAVCTLEEPIYIITELMTNGSLLEYLQKDKGRTLRISDQIEMAAQVASGMAF
LELQNYIHRDLAARNVLVGENNICKVADFGLARVFMKESENVYEAKEGTKFPVKWTAPEA
IHDNRFTIKSDVWSFGILLYEIVTFGQMPYPAMTNFQVVQKLAEGYRMPCPANCPKVLYD
IMKDCWKENEQTRPTFETLQWKLEDYFEQDVTSYDDATRY
Download sequence
Identical sequences I3JZI4
ENSONIP00000014279 XP_003453057.1.78416 ENSONIP00000014279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]